| UniProt ID | GRC3_YEAST | |
|---|---|---|
| UniProt AC | Q07845 | |
| Protein Name | Polynucleotide 5'-hydroxyl-kinase GRC3 | |
| Gene Name | GRC3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 632 | |
| Subcellular Localization | Nucleus, nucleolus . Associates with rDNA. | |
| Protein Description | Polynucleotide 5'-kinase involved in rRNA processing. Required for the efficient termination by RNA polymerase I and the processing of the IST2 pre-rRNA internal transcribed spacer localized between the 5.8S and 25S rRNAs. May act by maintaining the phosphorylated status of the downstream RNT1 cleavage product, which in turn allows the torpedo activity of RAT1 to efficiently terminate Pol I transcription. In vitro, displays polynucleotide kinase activity on both single- and double-stranded RNA and on single-stranded DNA alone, but not double-stranded DNA alone.. | |
| Protein Sequence | MVIDSKQDLPQYTKDSGSESDSDSSNNFIVESPSIPSSKSATVVLNSEEYEDDEGDDLNGLDAELIDNITYEGDEDETMFVGLKEKQKLHLSGVFRLQVVKGGIVYNNVHYNASREILTFWHPLSQSIPTIDFSHFAGWQDTFFMPRNNRFKIRDEEFKSFPCVLRVFNSNHTGLLEAGHLYRDVNYLWKPKEPYFPLNERTTYHLLHESDRIQSLSVPGYWSTPLEKLYLSHKNAAYDTRIMVIGGKNSGKSTFLRLLLEKFTQDIRDSTTSQEELVYLDLDPGQPEYSLPDSISLNKILSSPISLGQHLCQGSNFQTLLQFYAGSSSPQDEPTSYLNCADKLIDHLEEQAFFGTSLLNLPGWIKGFGMQILNHIIRKYKPTHLLFLETANSKRHLDELTIPQSFSTSLRDAYAPEVVRVPAHSLNHTLSSRFHASQLRTFKILALFHKITQFDYDFAPLLKSAPLQISYGKGKSGIKGIQFPMEFQDLNPQDIKSALEGTVIGIYTYSGEDSLEVKSLNTFPILQSCTSSSKNFITLGLIHSIDTSQQIMNIYVPPCHTQILDKQPEDAQWIIVRNKTETPFCDFLPSPRTITWDDNIQIPFATFERRKKLEHVWKVRKNVMRRGQFMKR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 425 | Phosphorylation | VVRVPAHSLNHTLSS EEEECHHHCCCCHHH | 32.73 | 19779198 | |
| 429 | Phosphorylation | PAHSLNHTLSSRFHA CHHHCCCCHHHCCCH | 27.54 | 19779198 | |
| 432 | Phosphorylation | SLNHTLSSRFHASQL HCCCCHHHCCCHHHH | 41.92 | 19779198 | |
| 590 | Phosphorylation | PFCDFLPSPRTITWD CCCCCCCCCCEECCC | 29.21 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GRC3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GRC3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GRC3_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
