| UniProt ID | FRE3_YEAST | |
|---|---|---|
| UniProt AC | Q08905 | |
| Protein Name | Ferric reductase transmembrane component 3 | |
| Gene Name | FRE3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 711 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein . |
|
| Protein Description | Siderophore-iron reductase responsible for reducing extracellular iron prior to import. Catalyzes the reductive uptake of Fe(3+) bound to di- and trihydroxamate siderophores. Fe(3+) is reduced to Fe(2+), which then dissociates from the siderophore and can be imported by the high-affinity Fe(2+) transport complex in the plasma membrane.. | |
| Protein Sequence | MYWVLLCGSILLCCLSGASASPAKTKMYGKLPLVLTDACMGVLGEVTWEYSSDDLYSSPACTYEPALQSMLYCIYESLNEKGYSNRTFEKTFAAIKEDCAYYTDNLQNMTNADFYNMLNNGTTYIIQYSEGSANLTYPIEMDAQVRENYYYSYHGFYANYDIGHTYGGIICAYFVGVMILASILHYLSYTPFKTALFKQRLVRYVRRYLTIPTIWGKHASSFSYLKIFTGFLPTRSEGVIILGYLVLHTVFLAYGYQYDPYNLIFDSRREQIARYVADRSGVLAFAHFPLIALFAGRNNFLEFISGVKYTSFIMFHKWLGRMMFLDAVIHGAAYTSYSVFYKDWAASKEETYWQFGVAALCIVGVMVFFSLAMFRKFFYEAFLFLHIVLGALFFYTCWEHVVELSGIEWIYAAIAIWTIDRLIRIVRVSYFGFPKASLQLVGDDIIRVTVKRPVRLWKAKPGQYVFVSFLHHLYFWQSHPFTVLDSIIKDGELTIILKEKKGVTKLVKKYVCCNGGKASMRLAIEGPYGSSSPVNNYDNVLLLTGGTGLPGPIAHAIKLGKTSAATGKQFIKLVIAVRGFNVLEAYKPELMCLEDLNVQLHIYNTMEVPALTPNDSLEISQQDEKADGKGVVMATTLEQSPNPVEFDGTVFHHGRPNVEKLLHEVGDLNGSLAVVCCGPPVFVDEVRDQTANLVLEKPAKAIEYFEEYQSW | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 85 | N-linked_Glycosylation | LNEKGYSNRTFEKTF HHHCCCCCCHHHHHH | 38.23 | - | |
| 108 | N-linked_Glycosylation | YYTDNLQNMTNADFY HHCCCCCCCCCHHHH | 42.27 | - | |
| 120 | N-linked_Glycosylation | DFYNMLNNGTTYIIQ HHHHHHHCCCEEEEE | 45.27 | - | |
| 134 | N-linked_Glycosylation | QYSEGSANLTYPIEM EECCCCCEEEEEEEE | 34.31 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FRE3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FRE3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FRE3_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
