UniProt ID | PAU13_YEAST | |
---|---|---|
UniProt AC | P38725 | |
Protein Name | Seripauperin-13 | |
Gene Name | PAU13 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 120 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MVKLTSIAAGVAAIAATASATTTLAQSDERVNLVELGVYVSDIRAHLAQYYMFQAAHPTETYPVEVAEAVFNYGDFTTMLTGIAPDQVTRMITGVPWYSSRLKPAISSALSKDGIYTITN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of PAU13_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAU13_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAU13_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAU13_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GDS1_YEAST | GDS1 | physical | 10688190 | |
PSA7_YEAST | PRE10 | genetic | 27708008 | |
KPC1_YEAST | PKC1 | genetic | 27708008 | |
KRR1_YEAST | KRR1 | genetic | 27708008 | |
NSE4_YEAST | NSE4 | genetic | 27708008 | |
CDC48_YEAST | CDC48 | genetic | 27708008 | |
RPB1_YEAST | RPO21 | genetic | 27708008 | |
SEC1_YEAST | SEC1 | genetic | 27708008 | |
CDC37_YEAST | CDC37 | genetic | 27708008 | |
RSP5_YEAST | RSP5 | genetic | 27708008 | |
MOB2_YEAST | MOB2 | genetic | 27708008 | |
PRP18_YEAST | PRP18 | genetic | 27708008 | |
SMD1_YEAST | SMD1 | genetic | 27708008 | |
MED6_YEAST | MED6 | genetic | 27708008 | |
CDC11_YEAST | CDC11 | genetic | 27708008 | |
YJ9I_YEAST | YJR141W | genetic | 27708008 | |
SSL1_YEAST | SSL1 | genetic | 27708008 | |
TAP42_YEAST | TAP42 | genetic | 27708008 | |
DIM1_YEAST | DIM1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...