| UniProt ID | SNX4_YEAST | |
|---|---|---|
| UniProt AC | P47057 | |
| Protein Name | Sorting nexin-4 | |
| Gene Name | SNX4 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 423 | |
| Subcellular Localization |
Cytoplasm. Membrane Peripheral membrane protein. Endosome membrane Peripheral membrane protein. Endosome and other perivacuolar punctate structures. Associates to phosphatidylinositol 3-phosphate, necessary for peripheral membrane localization to t |
|
| Protein Description | Sorting nexin, involved in the separation or division of vacuoles throughout the entire life cycle of the cells (By similarity). Involved in retrieval of late-Golgi SNAREs from post-Golgi endosomes to the trans-Golgi network, for cytoplasm to vacuole transport (Cvt), mitophagy, and pexophagy. Involved in proper sorting of the v-SNARE protein SNC1.. | |
| Protein Sequence | MTDKGKNDLTSKAKDKARGNPEKPPYWFEIIVSDPQKRTGDPGSSSGYVSYQISTKTNNTSFYDNRGDPESIIVVHRRYSDLLLLHDILLNRFPTCIIPPLPDKKVFQYIAGDRFSQRFTQKRCHSLQNFLRRVSLHPDLSQSKVFKTFLVSKDWESHRKVLQDSLQPNKDEVTDAFMNAFKTVHKQNEEFTEIREKSDKLDRTVTKIDKLFHKVVKKNDSMSEDYTKLGSNLQELQELVTGENEELAAKLKIFNEGVTQLSYGLQDLTKYLDYEYIVDLKDLEHYIDSMRQLIKLKDQKQIDYEELSDYLTRSIKEKNNLISGYGGSNFFANKLEELAGINQEASRREKINKLEGKITSLTGELENAKKVADGFEQECLKEIDHFESVKTAEIKKSLGSLADHHIEFYERILEAWEKVDDSL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 60 | Phosphorylation | ISTKTNNTSFYDNRG EEECCCCCCCCCCCC | 23.45 | 19684113 | |
| 61 | Phosphorylation | STKTNNTSFYDNRGD EECCCCCCCCCCCCC | 24.75 | 19684113 | |
| 144 | Acetylation | HPDLSQSKVFKTFLV CCCCCCCHHHHHEEE | 44.01 | 24489116 | |
| 221 | Phosphorylation | KVVKKNDSMSEDYTK HHHHCCCCCCHHHHH | 33.33 | 30377154 | |
| 300 | Acetylation | LIKLKDQKQIDYEEL HHHHHHHHCCCHHHH | 60.39 | 24489116 | |
| 328 | Phosphorylation | LISGYGGSNFFANKL CCCCCCCCHHHHHHH | 26.54 | 21551504 | |
| 396 | Ubiquitination | VKTAEIKKSLGSLAD HCHHHHHHHHHHHHH | 57.48 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SNX4_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SNX4_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SNX4_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
