SPO73_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPO73_YEAST
• UniProt AC: P40031
• Protein Name: Sporulation-specific protein 73
• Gene Name: SPO73
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 143
• Subcellular Localization: Cytoplasm . Punctate location throughout the cytosol in meiosis II cells and peripheral punctate structures in the spore.
• Protein Description: Required for spore wall assembly and ascus formation..
• Protein Sequence: MGKNHFLKDFSALPEDVLIENERGITLLGYPLFSPKILLPHVDPPQFQRLNTENGSLIALSKNTISNFIELYPIDLSTERTAGSSSSQMTKWFVLMDYKEKYDIDDQGWCYSWNFNNSRWKSKNGLVRRRVWVRLPTTSHGLD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
52	Phosphorylation	PQFQRLNTENGSLIA HHHHEEECCCCCEEE	35.10	27017623
56	Phosphorylation	RLNTENGSLIALSKN EEECCCCCEEECCCC	28.34	27214570
61	Phosphorylation	NGSLIALSKNTISNF CCCEEECCCCHHHCC	18.16	27017623

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SPO73_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPO73_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPO73_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SPO1_YEAST	SPO1	genetic	27303688
SMA2_YEAST	SMA2	genetic	27303688

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.