| UniProt ID | DPM1_YEAST | |
|---|---|---|
| UniProt AC | P14020 | |
| Protein Name | Dolichol-phosphate mannosyltransferase | |
| Gene Name | DPM1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 267 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type IV membrane protein . |
|
| Protein Description | Transfers mannose from GDP-mannose to dolichol monophosphate to form dolichol phosphate mannose (Dol-P-Man) which is the mannosyl donor in pathways leading to N-glycosylation, glycosyl phosphatidylinositol membrane anchoring, and O-mannosylation of proteins.. | |
| Protein Sequence | MSIEYSVIVPAYHEKLNIKPLTTRLFAGMSPEMAKKTELIFVDDNSQDGSVEEVDALAHQGYNVRIIVRTNERGLSSAVLKGFYEAKGQYLVCMDADLQHPPETVPKLFESLHDHAFTLGTRYAPGVGIDKDWPMYRRVISSTARMMARPLTIASDPMSGFFGLQKKYLENCNPRDINSQGFKIALELLAKLPLPRDPRVAIGEVPFTFGVRTEGESKLSGKVIIQYLQQLKELYVFKFGANNLILFITFWSILFFYVCYQLYHLVF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSIEYSVIV ------CCCEEEEEE | 24.91 | - | |
| 2 | Phosphorylation | ------MSIEYSVIV ------CCCEEEEEE | 24.91 | 28889911 | |
| 5 | Phosphorylation | ---MSIEYSVIVPAY ---CCCEEEEEEHHH | 13.43 | 28889911 | |
| 6 | Phosphorylation | --MSIEYSVIVPAYH --CCCEEEEEEHHHH | 7.80 | 28889911 | |
| 35 | Succinylation | GMSPEMAKKTELIFV CCCHHHHHCCEEEEE | 59.94 | 23954790 | |
| 35 | Ubiquitination | GMSPEMAKKTELIFV CCCHHHHHCCEEEEE | 59.94 | 17644757 | |
| 35 | Acetylation | GMSPEMAKKTELIFV CCCHHHHHCCEEEEE | 59.94 | 24489116 | |
| 36 | Ubiquitination | MSPEMAKKTELIFVD CCHHHHHCCEEEEEC | 37.38 | 17644757 | |
| 81 | Acetylation | GLSSAVLKGFYEAKG CCCHHHHCCHHHHCC | 40.13 | 24489116 | |
| 107 | Ubiquitination | HPPETVPKLFESLHD CCCCHHHHHHHHHHH | 62.56 | 17644757 | |
| 131 | Acetylation | APGVGIDKDWPMYRR CCCCCCCCCCHHHHH | 60.83 | 24489116 | |
| 141 | Phosphorylation | PMYRRVISSTARMMA HHHHHHHHHHHHHHC | 20.84 | 28889911 | |
| 152 | Phosphorylation | RMMARPLTIASDPMS HHHCCCEEECCCCCC | 19.72 | 29688323 | |
| 155 | Phosphorylation | ARPLTIASDPMSGFF CCCEEECCCCCCCCC | 38.09 | 29688323 | |
| 166 | Ubiquitination | SGFFGLQKKYLENCN CCCCHHHHHHHHHCC | 48.72 | 17644757 | |
| 166 | Acetylation | SGFFGLQKKYLENCN CCCCHHHHHHHHHCC | 48.72 | 24489116 | |
| 167 | Ubiquitination | GFFGLQKKYLENCNP CCCHHHHHHHHHCCH | 41.95 | 23749301 | |
| 167 | Acetylation | GFFGLQKKYLENCNP CCCHHHHHHHHHCCH | 41.95 | 25381059 | |
| 191 | Acetylation | IALELLAKLPLPRDP HHHHHHHCCCCCCCC | 51.08 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 141 | S | Phosphorylation | Kinase | PKA-FAMILY | - | GPS |
| 141 | S | Phosphorylation | Kinase | PKA | - | Uniprot |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DPM1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DPM1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
