UniProt ID | SNC1_YEAST | |
---|---|---|
UniProt AC | P31109 | |
Protein Name | Synaptobrevin homolog 1 | |
Gene Name | SNC1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 117 | |
Subcellular Localization |
Endomembrane system Single-pass type IV membrane protein. Post-Golgi vesicle membrane. |
|
Protein Description | SNC1 and SNC2 are vesicle-targeting proteins essential for normal secretory traffic between the Golgi and the plasma membrane. They may also be involved in vesicle fusion.. | |
Protein Sequence | MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKAMWYKDLKMKMCLALVIIILLVVIIVPIAVHFSR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSSSTPFDP ------CCCCCCCCC | 32.75 | 22369663 | |
3 | Phosphorylation | -----MSSSTPFDPY -----CCCCCCCCCC | 36.61 | 22369663 | |
4 | Phosphorylation | ----MSSSTPFDPYA ----CCCCCCCCCCC | 32.56 | 22369663 | |
5 | Phosphorylation | ---MSSSTPFDPYAL ---CCCCCCCCCCCC | 29.89 | 22369663 | |
10 | Phosphorylation | SSTPFDPYALSEHDE CCCCCCCCCCCCCCC | 23.24 | 22369663 | |
13 | Phosphorylation | PFDPYALSEHDEERP CCCCCCCCCCCCCCC | 25.39 | 22369663 | |
25 | Phosphorylation | ERPQNVQSKSRTAEL CCCCCHHCCHHHHHH | 28.46 | 22369663 | |
26 | Ubiquitination | RPQNVQSKSRTAELQ CCCCHHCCHHHHHHH | 27.19 | 24961812 | |
27 | Phosphorylation | PQNVQSKSRTAELQA CCCHHCCHHHHHHHH | 39.86 | 19779198 | |
29 | Phosphorylation | NVQSKSRTAELQAEI CHHCCHHHHHHHHHH | 31.41 | 21440633 | |
49 | Ubiquitination | IMRDNINKVAERGER HHHHHHHHHHHHHHC | 38.74 | 23749301 | |
58 | Phosphorylation | AERGERLTSIEDKAD HHHHHCCCCHHHHHH | 33.60 | 20377248 | |
59 | Phosphorylation | ERGERLTSIEDKADN HHHHCCCCHHHHHHH | 28.68 | 22369663 | |
63 | Ubiquitination | RLTSIEDKADNLAVS CCCCHHHHHHHHHHH | 44.86 | 23749301 | |
63 | Acetylation | RLTSIEDKADNLAVS CCCCHHHHHHHHHHH | 44.86 | 24489116 | |
70 | Phosphorylation | KADNLAVSAQGFKRG HHHHHHHHHHHHHHH | 14.85 | 22369663 | |
75 | Ubiquitination | AVSAQGFKRGANRVR HHHHHHHHHHHHHHH | 57.66 | 23749301 | |
75 | Acetylation | AVSAQGFKRGANRVR HHHHHHHHHHHHHHH | 57.66 | 24489116 | |
95 | S-palmitoylation | KDLKMKMCLALVIII HHHHHHHHHHHHHHH | 1.35 | - | |
95 | S-palmitoylation | KDLKMKMCLALVIII HHHHHHHHHHHHHHH | 1.35 | 15973437 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SNC1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SNC1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SNC1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Palmitoylation | |
Reference | PubMed |
"Swf1-dependent palmitoylation of the SNARE Tlg1 prevents itsubiquitination and degradation."; Valdez-Taubas J., Pelham H.R.B.; EMBO J. 24:2524-2532(2005). Cited for: PALMITOYLATION AT CYS-95. | |
Ubiquitylation | |
Reference | PubMed |
"A proteomics approach to understanding protein ubiquitination."; Peng J., Schwartz D., Elias J.E., Thoreen C.C., Cheng D.,Marsischky G., Roelofs J., Finley D., Gygi S.P.; Nat. Biotechnol. 21:921-926(2003). Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-63, AND MASSSPECTROMETRY. |