| UniProt ID | YIT6_YEAST | |
|---|---|---|
| UniProt AC | P40572 | |
| Protein Name | Uncharacterized protein YIR016W | |
| Gene Name | YIR016W | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 265 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MSGTRCLLGVGLPVDVTATETLTHDEQGPGVEPGPCSRGSSIDGLLPSLLGPHDDVDDDSAAFHKYMTLSRDGAGAIHAPSLVEDASRNDDDDDDEDDDDSSMSRDLSKALDMSSSSSSSPRVQSRRHRSSVSAISAILHQGKSGREDITGSLSVPAEQEKLSFLAKASSIFFRRNSMPRDKHTHSVCPASRPDSERFIVTSAAAQSLRRQQQLEDAQYARVITNFRTIGWCSPSEIESVEYKRSLINAEWDEKISLLSHAQCYK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 40 | Phosphorylation | PGPCSRGSSIDGLLP CCCCCCCCCCCCCCH | 24.02 | 22369663 | |
| 41 | Phosphorylation | GPCSRGSSIDGLLPS CCCCCCCCCCCCCHH | 27.76 | 22369663 | |
| 48 | Phosphorylation | SIDGLLPSLLGPHDD CCCCCCHHHHCCCCC | 35.87 | 22369663 | |
| 87 | Phosphorylation | PSLVEDASRNDDDDD CCHHCCHHCCCCCCC | 43.89 | 29650682 | |
| 102 | Phosphorylation | DEDDDDSSMSRDLSK CCCCCCHHHHHHHHH | 27.98 | 27017623 | |
| 114 | Phosphorylation | LSKALDMSSSSSSSP HHHHHCCCCCCCCCH | 27.08 | 22369663 | |
| 115 | Phosphorylation | SKALDMSSSSSSSPR HHHHCCCCCCCCCHH | 27.83 | 22369663 | |
| 116 | Phosphorylation | KALDMSSSSSSSPRV HHHCCCCCCCCCHHH | 27.25 | 22369663 | |
| 117 | Phosphorylation | ALDMSSSSSSSPRVQ HHCCCCCCCCCHHHH | 35.87 | 22369663 | |
| 118 | Phosphorylation | LDMSSSSSSSPRVQS HCCCCCCCCCHHHHC | 36.46 | 22369663 | |
| 119 | Phosphorylation | DMSSSSSSSPRVQSR CCCCCCCCCHHHHCH | 46.43 | 22369663 | |
| 120 | Phosphorylation | MSSSSSSSPRVQSRR CCCCCCCCHHHHCHH | 20.76 | 22369663 | |
| 130 | Phosphorylation | VQSRRHRSSVSAISA HHCHHHHHHHHHHHH | 29.03 | 22369663 | |
| 131 | Phosphorylation | QSRRHRSSVSAISAI HCHHHHHHHHHHHHH | 21.76 | 22369663 | |
| 133 | Phosphorylation | RRHRSSVSAISAILH HHHHHHHHHHHHHHH | 23.10 | 22369663 | |
| 136 | Phosphorylation | RSSVSAISAILHQGK HHHHHHHHHHHHCCC | 14.69 | 23749301 | |
| 154 | Phosphorylation | EDITGSLSVPAEQEK CCCCCCCCCCHHHHH | 27.96 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YIT6_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YIT6_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YIT6_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
