| UniProt ID | EFM6_YEAST | |
|---|---|---|
| UniProt AC | P53970 | |
| Protein Name | Protein-lysine N-methyltransferase EFM6 {ECO:0000255|HAMAP-Rule:MF_03198, ECO:0000305|PubMed:26115316} | |
| Gene Name | EFM6 {ECO:0000255|HAMAP-Rule:MF_03198, ECO:0000303|PubMed:26115316} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 246 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | S-adenosyl-L-methionine-dependent protein-lysine N-methyltransferase that methylates elongation factor 1-alpha (TEF1 and TEF2) at 'Lys-390'.. | |
| Protein Sequence | MESIFGGFGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSVDHLLSKTVNGTKQFKKVLELGSGTGLVGLCVGLLEKNTFHDGTKVYVTDIDKLIPLLKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAADCVYLEEAFPLLEKTLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKERTHLFQLIRK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of EFM6_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EFM6_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EFM6_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EFM6_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CDC20_YEAST | CDC20 | physical | 16554755 | |
| SMD2_YEAST | SMD2 | physical | 16554755 | |
| YO093_YEAST | YOR093C | physical | 16554755 | |
| SYFM_YEAST | MSF1 | physical | 16554755 | |
| MUS81_YEAST | MUS81 | physical | 18719252 | |
| RS8A_YEAST | RPS8A | genetic | 27708008 | |
| RS8B_YEAST | RPS8A | genetic | 27708008 | |
| GPR1_YEAST | GPR1 | genetic | 27708008 | |
| YG036_YEAST | YGL036W | genetic | 27708008 | |
| YIF4_YEAST | YIL054W | genetic | 27708008 | |
| MNS1_YEAST | MNS1 | genetic | 27708008 | |
| FEN1_YEAST | RAD27 | genetic | 27708008 | |
| CTK1_YEAST | CTK1 | genetic | 27708008 | |
| UBR2_YEAST | UBR2 | genetic | 27708008 | |
| INO4_YEAST | INO4 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
