UniProt ID | AIM19_YEAST | |
---|---|---|
UniProt AC | P40502 | |
Protein Name | Altered inheritance of mitochondria protein 19, mitochondrial | |
Gene Name | AIM19 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 157 | |
Subcellular Localization |
Mitochondrion membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MSAKPATDDAKDELLSPFRRLYALTRTPYPALANAALLASTPVLSPSFKVPPTQSPALSIPMSRVFSKSSTARIGITTKTALFFSTMQAIGAYMIYDNDLENGAGFIATWSALYLIVGGKKSFSALRYGRTWPLVLSSVSLANAVLYGQRFLATGFQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSAKPATDD ------CCCCCCCHH | 45.03 | 22814378 | |
53 | Phosphorylation | PSFKVPPTQSPALSI CCCCCCCCCCCCCCC | 35.29 | 23607784 | |
55 | Phosphorylation | FKVPPTQSPALSIPM CCCCCCCCCCCCCCH | 18.02 | 23607784 | |
59 | Phosphorylation | PTQSPALSIPMSRVF CCCCCCCCCCHHHHC | 27.10 | 23607784 | |
63 | Phosphorylation | PALSIPMSRVFSKSS CCCCCCHHHHCCCCC | 21.67 | 23607784 | |
67 | Phosphorylation | IPMSRVFSKSSTARI CCHHHHCCCCCCCEE | 28.86 | 23607784 | |
69 | Phosphorylation | MSRVFSKSSTARIGI HHHHCCCCCCCEECC | 31.55 | 23607784 | |
70 | Phosphorylation | SRVFSKSSTARIGIT HHHCCCCCCCEECCC | 29.80 | 23607784 | |
71 | Phosphorylation | RVFSKSSTARIGITT HHCCCCCCCEECCCH | 27.35 | 23607784 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AIM19_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AIM19_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AIM19_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MRM2_YEAST | MRM2 | genetic | 27708008 | |
VRP1_YEAST | VRP1 | genetic | 27708008 | |
INO4_YEAST | INO4 | genetic | 27708008 | |
CWH43_YEAST | CWH43 | genetic | 27708008 | |
SLF1_YEAST | SLF1 | genetic | 27708008 | |
IES1_YEAST | IES1 | genetic | 27708008 | |
KSP1_YEAST | KSP1 | genetic | 27708008 | |
NFU1_YEAST | NFU1 | genetic | 27708008 | |
FABG_YEAST | OAR1 | genetic | 27708008 | |
APC9_YEAST | APC9 | genetic | 27708008 | |
NAH1_YEAST | NHA1 | genetic | 27708008 | |
YL413_YEAST | INA1 | genetic | 27708008 | |
CDC73_YEAST | CDC73 | genetic | 27708008 | |
PSP2_YEAST | PSP2 | genetic | 27708008 | |
RGA1_YEAST | RGA1 | genetic | 27708008 | |
WDR6_YEAST | RTT10 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...