UniProt ID | YAJ8_YEAST | |
---|---|---|
UniProt AC | P39548 | |
Protein Name | DUP240 protein YAR028W | |
Gene Name | YAR028W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 234 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MQTPSENTDVKMDTLDEPSAHLIEENVALPEDTFSSHLSYVLYEIAHCKPIMFMIIIIVSLISLIVLFHDNDGCTVILVMSLIVASMALMVVAAFTFGKAITEQEFMIKLLVEVIARKPAGKEWGTVAYNMNQYLFMKRLWYTPYYFYSGKKCHEFFTTLIKEVNSGSHSDSSSNSAEDTQSPVSAGKTSNGLNNFYSIRSDPILMAYVLKATQIEKEAQSEYWRKQYPDADLP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MQTPSENTDV -----CCCCCCCCCC | 27.73 | 21126336 | |
5 | Phosphorylation | ---MQTPSENTDVKM ---CCCCCCCCCCCC | 47.03 | 27717283 | |
8 | Phosphorylation | MQTPSENTDVKMDTL CCCCCCCCCCCCCCC | 37.81 | 27717283 | |
118 | Ubiquitination | LVEVIARKPAGKEWG HHHHHHCCCCCCCCC | 30.14 | 22817900 | |
122 | Ubiquitination | IARKPAGKEWGTVAY HHCCCCCCCCCCEEE | 53.02 | 22817900 | |
142 | Phosphorylation | LFMKRLWYTPYYFYS HHHHHHHCCCEEEEC | 11.48 | 30377154 | |
143 | Phosphorylation | FMKRLWYTPYYFYSG HHHHHHCCCEEEECC | 8.01 | 28889911 | |
145 | Phosphorylation | KRLWYTPYYFYSGKK HHHHCCCEEEECCCH | 9.82 | 30377154 | |
146 | Phosphorylation | RLWYTPYYFYSGKKC HHHCCCEEEECCCHH | 9.39 | 30377154 | |
148 | Phosphorylation | WYTPYYFYSGKKCHE HCCCEEEECCCHHHH | 10.61 | 28889911 | |
149 | Phosphorylation | YTPYYFYSGKKCHEF CCCEEEECCCHHHHH | 33.95 | 28889911 | |
166 | Phosphorylation | TLIKEVNSGSHSDSS HHHHHHHCCCCCCCC | 47.01 | 22369663 | |
168 | Phosphorylation | IKEVNSGSHSDSSSN HHHHHCCCCCCCCCC | 21.46 | 22369663 | |
170 | Phosphorylation | EVNSGSHSDSSSNSA HHHCCCCCCCCCCCC | 40.67 | 20377248 | |
172 | Phosphorylation | NSGSHSDSSSNSAED HCCCCCCCCCCCCCC | 38.39 | 23749301 | |
173 | Phosphorylation | SGSHSDSSSNSAEDT CCCCCCCCCCCCCCC | 38.23 | 22369663 | |
174 | Phosphorylation | GSHSDSSSNSAEDTQ CCCCCCCCCCCCCCC | 38.46 | 22369663 | |
176 | Phosphorylation | HSDSSSNSAEDTQSP CCCCCCCCCCCCCCC | 34.68 | 22369663 | |
180 | Phosphorylation | SSNSAEDTQSPVSAG CCCCCCCCCCCCCCC | 23.58 | 22369663 | |
182 | Phosphorylation | NSAEDTQSPVSAGKT CCCCCCCCCCCCCCC | 29.39 | 22369663 | |
185 | Phosphorylation | EDTQSPVSAGKTSNG CCCCCCCCCCCCCCC | 34.39 | 22369663 | |
188 | Ubiquitination | QSPVSAGKTSNGLNN CCCCCCCCCCCCCCC | 48.79 | 23749301 | |
217 | Ubiquitination | LKATQIEKEAQSEYW HHHHHHHHHHHHHHH | 61.04 | 23749301 | |
226 | Ubiquitination | AQSEYWRKQYPDADL HHHHHHHHHCCCCCC | 39.78 | 23749301 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YAJ8_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YAJ8_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YAJ8_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases."; Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.; Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-182, AND MASSSPECTROMETRY. | |
Ubiquitylation | |
Reference | PubMed |
"A subset of membrane-associated proteins is ubiquitinated in responseto mutations in the endoplasmic reticulum degradation machinery."; Hitchcock A.L., Auld K., Gygi S.P., Silver P.A.; Proc. Natl. Acad. Sci. U.S.A. 100:12735-12740(2003). Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-217, AND MASSSPECTROMETRY. |