| UniProt ID | HAP5_YEAST | |
|---|---|---|
| UniProt AC | Q02516 | |
| Protein Name | Transcriptional activator HAP5 | |
| Gene Name | HAP5 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 242 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Acts a component of the CCAT-binding factor, which is a transcriptional activator and binds to the upstream activation site (UAS2) of the CYC1 gene and other genes involved in mitochondrial electron transport and activates their expression. Recognizes the sequence 5'-CCAAT-3'. HAP5 is essential for DNA-binding activity. It may be the linchpin that binds to the subunit association domains (SAD) of HAP2 and HAP3 to bring these proteins together.. | |
| Protein Sequence | MTDRNFSPQQGQGPQESLPEGPQPSTMIQREEMNMPRQYSEQQQLQENEGEGENTRLPVSEEEFRMVQELQAIQAGHDQANLPPSGRGSLEGEDNGNSDGADGEMDEDDEEYDVFRNVGQGLVGHYKEIMIRYWQELINEIESTNEPGSEHQDDFKSHSLPFARIRKVMKTDEDVKMISAEAPIIFAKACEIFITELTMRAWCVAERNKRRTLQKADIAEALQKSDMFDFLIDVVPRRPLPQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MTDRNFSPQ ------CCCCCCCCC | 43.60 | 22369663 | |
| 7 | Phosphorylation | -MTDRNFSPQQGQGP -CCCCCCCCCCCCCC | 25.91 | 22369663 | |
| 25 | Phosphorylation | LPEGPQPSTMIQREE CCCCCCCCHHHHHHH | 25.92 | 27017623 | |
| 26 | Phosphorylation | PEGPQPSTMIQREEM CCCCCCCHHHHHHHH | 25.61 | 27017623 | |
| 39 | Phosphorylation | EMNMPRQYSEQQQLQ HHCCCCCCHHHHHHH | 18.56 | 30377154 | |
| 40 | Phosphorylation | MNMPRQYSEQQQLQE HCCCCCCHHHHHHHH | 22.16 | 30377154 | |
| 60 | Phosphorylation | ENTRLPVSEEEFRMV CCCCCCCCHHHHHHH | 37.03 | 27214570 | |
| 89 | Phosphorylation | LPPSGRGSLEGEDNG CCCCCCCCCCCCCCC | 23.14 | 27214570 | |
| 98 | Phosphorylation | EGEDNGNSDGADGEM CCCCCCCCCCCCCCC | 38.53 | 28152593 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HAP5_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HAP5_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HAP5_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-7, AND MASSSPECTROMETRY. | |
