RT17_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RT17_YEAST
• UniProt AC: Q03246
• Protein Name: 37S ribosomal protein S17, mitochondrial
• Gene Name: MRPS17
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 237
• Subcellular Localization: Mitochondrion . Mitoribosomes are tethered to the mitochondrial inner membrane and spatially aligned with the membrane insertion machinery through two distinct membrane contact sites, formed by the 21S rRNA expansion segment 96-ES1 and the inner memb
• Protein Description: Component of the mitochondrial ribosome (mitoribosome), a dedicated translation machinery responsible for the synthesis of mitochondrial genome-encoded proteins, including at least some of the essential transmembrane subunits of the mitochondrial respiratory chain. The mitoribosomes are attached to the mitochondrial inner membrane and translation products are cotranslationally integrated into the membrane. [PubMed: 25609543]
• Protein Sequence: MARQNFLGLVVSQGKMQKTVKVRVETKVFNKKINKELFHRRDYLVHDEGEISREGDLVRIEATRPLSKRKFFAIAEIIRNKGQQFALYESEAQLSVAKEEAQKAKEFLDKRSVRENKLNEKTTLLRDIRTIQDALSSGSTPKELLEIKQRYGIQDFSQETVRQLLQLDISGLEVNLEKQRSLIDRIQTRLSELLSNDLKCDQFLKDHGVEDPLTLKKNIKKNLLRKHVMMDMQQPSQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
43	Phosphorylation	ELFHRRDYLVHDEGE HHHCCCCEEECCCCC	14.60	27017623
121	Acetylation	RENKLNEKTTLLRDI HHHHCCCHHHHHHHH	45.82	25381059
216	Acetylation	VEDPLTLKKNIKKNL CCCCHHHCHHHHHHH	38.24	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RT17_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RT17_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RT17_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RT13_YEAST	MRP13	physical	16554755
RT27_YEAST	RSM27	physical	16554755
LNP_YEAST	LNP1	physical	22875988
HSK3_YEAST	HSK3	physical	22875988
SED5_YEAST	SED5	physical	22875988
RT17_YEAST	MRPS17	physical	22875988
VAM3_YEAST	VAM3	physical	22875988
HMS2_YEAST	HMS2	physical	22875988
ATPB_YEAST	ATP2	genetic	27811238

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.