| UniProt ID | DID2_YEAST | |
|---|---|---|
| UniProt AC | P69771 | |
| Protein Name | Vacuolar protein-sorting-associated protein 46 | |
| Gene Name | DID2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 204 | |
| Subcellular Localization |
Endosome membrane Peripheral membrane protein. Endomembrane system Peripheral membrane protein. Endosomal and other punctate structures. |
|
| Protein Description | Class E VPS protein implicated in concentration and sorting of cargo proteins of the multivesicular body (MVB) for incorporation into intralumenal vesicles. The lumenal sequestrated membrane proteins will be targeted into the vacuole after fusion of the endosome with the vacuole. Probably acts as a peripherally associated component of the ESCRT-III complex, which appears to be critical for late steps in MVB sorting, such as membrane invagination and final cargo sorting and recruits late-acting components of the sorting machinery. The MVB pathway requires the sequential function of ESCRT-O, -I,-II and -III complex assemblies. Regulates the membrane association of VPS4. Can stimulate VPS4 ATPase activity directly or via VTA1.. | |
| Protein Sequence | MSRNSAAGLENTLFQLKFTSKQLQKQANKASKEEKQETNKLKRALNENEDISRIYASNAIRKKNERLQLLKLASRVDSVASRVQTAVTMRQVSASMGQVCKGMDKALQNMNLQQITMIMDKFEQQFEDLDTSVNVYEDMGVNSDAMLVDNDKVDELMSKVADENGMELKQSAKLDNVPEIKAKEVNVDDEKEDKLAQRLRALRG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSRNSAAGL ------CCCCCHHHH | 39.92 | 30377154 | |
| 5 | Phosphorylation | ---MSRNSAAGLENT ---CCCCCHHHHHHH | 20.56 | 28889911 | |
| 17 | Ubiquitination | ENTLFQLKFTSKQLQ HHHHHHHHHCHHHHH | 35.49 | 23749301 | |
| 71 | Acetylation | NERLQLLKLASRVDS HHHHHHHHHHHHHHH | 51.07 | 24489116 | |
| 78 | Phosphorylation | KLASRVDSVASRVQT HHHHHHHHHHHHHHH | 19.41 | 30377154 | |
| 173 | Acetylation | MELKQSAKLDNVPEI CCHHHHHCCCCCCCC | 62.71 | 24489116 | |
| 181 | Ubiquitination | LDNVPEIKAKEVNVD CCCCCCCHHHCCCCC | 52.31 | 23749301 | |
| 191 | Acetylation | EVNVDDEKEDKLAQR CCCCCCHHHHHHHHH | 77.52 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DID2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DID2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DID2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
