UniProt ID | ATG39_YEAST | |
---|---|---|
UniProt AC | Q06159 | |
Protein Name | Autophagy-related protein 39 {ECO:0000303|PubMed:26040717} | |
Gene Name | ATG39 {ECO:0000303|PubMed:26040717} | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 398 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein . Preautophagosomal structure membrane Single-pass membrane protein . |
|
Protein Description | Acts as a receptor for reticulophagy and nucleophagy. Directs autophagic sequestration of double-membrane vesicles derived from the nuclear envelope and perinuclear endoplasmic reticulum (pnER) into autophagosomes. Is not required for the cytoplasm-to-vacuole targeting pathway, mitophagy, pexophagy, and non-selective autophagy.. | |
Protein Sequence | MSEEDDHWNLVRLRRLRKGREGEEQSSKSEISLDSLHESSFAGEDDEDFDADVLSNTSSEESAQMNRIYDFRTSNEFSNAGVNIDQTGVPTISESFDTLSGSNVGGTVLPSMEGSKLKDSTIRNSSTLSDHIIDKSEGKSAKLKMWHVIMLSSLLSMTFSYLALEYSLTGDVLAGFKSQQSLRNNERKLLYGNIDFVDKKSYDSSSDSLSQWAPSGKYYVDFDNHIAYPLKDDDLMGWRRYKTDLVILWYTTKARMKDGWHKRINKINGGRIKLHLFLKNSFKSAQESLRVLHKEQKRRWKRLFVLLHNKYRQFSPHIKRYFDHSCQKAKQCWSGSRLQLRKLRFKSMKPFRVFQFKVRKDTNWFVKQLKRFGLKLQHSRMYKAMSECRKKNYFKCKH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSEEDDHWN ------CCHHHCHHH | 28152593 | ||
120 | Phosphorylation | EGSKLKDSTIRNSST CCCCCCCCCCCCCCC | 24961812 | ||
121 | Phosphorylation | GSKLKDSTIRNSSTL CCCCCCCCCCCCCCH | 24961812 | ||
125 | Phosphorylation | KDSTIRNSSTLSDHI CCCCCCCCCCHHHHE | 24961812 | ||
126 | Phosphorylation | DSTIRNSSTLSDHII CCCCCCCCCHHHHEE | 24961812 | ||
127 | Phosphorylation | STIRNSSTLSDHIID CCCCCCCCHHHHEEE | 24961812 | ||
129 | Phosphorylation | IRNSSTLSDHIIDKS CCCCCCHHHHEEECC | 24961812 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATG39_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATG39_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATG39_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...