UniProt ID | ATG40_YEAST | |
---|---|---|
UniProt AC | Q99325 | |
Protein Name | Autophagy-related protein 40 {ECO:0000303|PubMed:26040717} | |
Gene Name | ATG40 {ECO:0000303|PubMed:26040717} | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 256 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein . Preautophagosomal structure membrane Single-pass membrane protein . |
|
Protein Description | Acts as a receptor for reticulophagy. Directs autophagic sequestration of folded tubules/sheets derived from the cortical endoplasmic reticulum (cER) and the cytoplasmic endoplasmic reticulum (cytoER) into autophagosomes. Is not required for the cytoplasm-to-vacuole targeting pathway, mitophagy, pexophagy, and non-selective autophagy.. | |
Protein Sequence | MFNLILWPLFLLTSVAIPLQLTLEVVYLTSSVDFSKASAAKTATSLGQSPVVITIYKSLLKYWSLYEFIHFIYLYTPIDAFLNFLPFTSLLMSFGSICLTRELVYDFIAFMESQNKLTGFLNKITEPNFNSYLLFSSIYNIWFADDTNDKFLFGKLTQILISVTKRYEFPRTFYLAKVSDFLQNLILTRLRPFVTEQPQGDKNRYQNGDRESTKNGAAYQKSSQQSSSFEQNFTSTEFPNDYDFMEDILDETTELD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of ATG40_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATG40_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATG40_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATG40_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GPR1_YEAST | GPR1 | genetic | 27708008 | |
TRS85_YEAST | TRS85 | genetic | 27708008 | |
GNTK_YEAST | YDR248C | genetic | 27708008 | |
VPS53_YEAST | VPS53 | genetic | 27708008 | |
PTK2_YEAST | PTK2 | genetic | 27708008 | |
STE24_YEAST | STE24 | genetic | 27708008 | |
ENV10_YEAST | ENV10 | genetic | 27708008 | |
YL225_YEAST | YLR225C | genetic | 27708008 | |
VPS9_YEAST | VPS9 | genetic | 27708008 | |
GBLP_YEAST | ASC1 | genetic | 27708008 | |
MKS1_YEAST | MKS1 | genetic | 27708008 | |
YME1_YEAST | YME1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...