dbPTM

IME1_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	IME1_YEAST
UniProt AC	P21190
Protein Name	Meiosis-inducing protein 1
Gene Name	IME1
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	360
Subcellular Localization	Nucleus.
Protein Description	Transcription factor required for sporulation and for early sporulation-specific genes expression. Positive regulator of SME1/IME2 expression. Directly activates expression of SLZ1 during meiosis..
Protein Sequence	MQADMHGKLHAALEDGFFLFPFEQQQQPNIYYDTTTDQEDRPCFSFGSTISPRSWHFEKSDKIASSQLQNLVHTQPIHLINPQILFNEEFLNLENIDSQPISKETKTTKDCTMATGPERGKKSSESTRSSSLSSLFSNDESASTFHSSFNNHDNFQKSNRNGDDIDISDTIKYETNTNAQKDIKIFQENFEFNEFPYTQDFYPYTTNYTYSKPTNIHESINSKNTDSYSQYQDQFPPHTDNIHSFNNRHYSNHKSTNCNYYNNTSNNNNASDNVYEADPFIDEPQVPSYYYPLEIAFDVEKSPPPSLQKLNSKELEFLKKLNSKLSRYAAAYSFSSSNDQDYYDKVRFQEISYKFSKTYS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
302	Phosphorylation	IAFDVEKSPPPSLQK EEEECCCCCCCHHHH	29.18	28889911
306	Phosphorylation	VEKSPPPSLQKLNSK CCCCCCCHHHHCCHH	49.56	28889911
359	Phosphorylation	SYKFSKTYS------ EEEEECCCC------	19.00	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of IME1_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of IME1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of IME1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RIM11_YEAST	RIM11	physical	10545448
UME6_YEAST	UME6	physical	10545448
UME6_YEAST	UME6	physical	9372955
UME6_YEAST	UME6	physical	9111339
RIM11_YEAST	RIM11	physical	15282298
IME1_YEAST	IME1	physical	8628320
RIM11_YEAST	RIM11	genetic	7969131
CDC25_YEAST	CDC25	genetic	2209544
RAS2_YEAST	RAS2	genetic	2209544
UME6_YEAST	UME6	physical	20541107
KIN28_YEAST	KIN28	genetic	20959818
ERT1_YEAST	ERT1	genetic	20959818
YP196_YEAST	YPR196W	genetic	20959818
CHD1_YEAST	CHD1	genetic	20959818
AF9_YEAST	YAF9	genetic	20959818
DOA1_YEAST	DOA1	genetic	20959818
LEO1_YEAST	LEO1	genetic	20959818
POG1_YEAST	POG1	genetic	20959818
SEM1_YEAST	SEM1	genetic	20959818
EAF7_YEAST	EAF7	genetic	20959818
IES1_YEAST	IES1	genetic	20959818
YPT6_YEAST	YPT6	genetic	20959818
THI2_YEAST	THI2	genetic	20959818
RAD52_YEAST	RAD52	genetic	1592244
RIM11_YEAST	RIM11	genetic	1592244
SPO13_YEAST	SPO13	genetic	1592244
IME2_YEAST	IME2	genetic	1592244
UME6_YEAST	UME6	genetic	1592244
HAL5_YEAST	HAL5	genetic	21127252
REI1_YEAST	REI1	genetic	21127252
GIS1_YEAST	GIS1	genetic	21127252
KCS1_YEAST	KCS1	genetic	21127252
RTG3_YEAST	RTG3	genetic	21127252
PP2C2_YEAST	PTC2	genetic	21127252
DUN1_YEAST	DUN1	genetic	21127252
DCC1_YEAST	DCC1	genetic	21127252

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of IME1_YEAST

Related Literatures of Post-Translational Modification