| UniProt ID | GLRX3_YEAST | |
|---|---|---|
| UniProt AC | Q03835 | |
| Protein Name | Monothiol glutaredoxin-3 | |
| Gene Name | GRX3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 250 | |
| Subcellular Localization | ||
| Protein Description | Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters (By similarity). Binds one iron-sulfur cluster per dimer. The iron-sulfur cluster is bound between subunits, and is complexed by a bound glutathione and a cysteine residue from each subunit (Probable).. | |
| Protein Sequence | MPVIEINDQEQFTYLTTTAAGDKLIVLYFHTSWAEPCKALKQVFEAISNEPSNSNVSFLSIDADENSEISELFEISAVPYFIIIHKGTILKELSGADPKEYVSLLEDCKNSVNSGSSQTHTMENANVNEGSHNDEDDDDEEEEEETEEQINARLTKLVNAAPVMLFMKGSPSEPKCGFSRQLVGILREHQVRFGFFDILRDESVRQNLKKFSEWPTFPQLYINGEFQGGLDIIKESLEEDPDFLQHALQS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 91 | 2-Hydroxyisobutyrylation | IHKGTILKELSGADP EECCCHHHHHCCCCH | 4.26 | - | |
| 91 | Acetylation | IHKGTILKELSGADP EECCCHHHHHCCCCH | 4.26 | 24489116 | |
| 99 | Acetylation | ELSGADPKEYVSLLE HHCCCCHHHHHHHHH | 52.44 | 24489116 | |
| 168 | Ubiquitination | APVMLFMKGSPSEPK CCEEEEECCCCCCCC | 56.94 | 24961812 | |
| 170 | Phosphorylation | VMLFMKGSPSEPKCG EEEEECCCCCCCCCC | 69.52 | 28152593 | |
| 172 | Phosphorylation | LFMKGSPSEPKCGFS EEECCCCCCCCCCCH | 64.31 | 21440633 | |
| 203 | Acetylation | FDILRDESVRQNLKK HHHHCCHHHHHHHHH | 49.23 | - | |
| 205 | Phosphorylation | ILRDESVRQNLKKFS HHCCHHHHHHHHHHH | 21.53 | 19060867 | |
| 250 | Phosphorylation | FLQHALQS------- HHHHHHHC------- | 21.80 | 21440633 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GLRX3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GLRX3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GLRX3_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
