| UniProt ID | MPD1_YEAST | |
|---|---|---|
| UniProt AC | Q12404 | |
| Protein Name | Protein disulfide-isomerase MPD1 | |
| Gene Name | MPD1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 318 | |
| Subcellular Localization | Endoplasmic reticulum lumen . | |
| Protein Description | Participates in the folding of proteins containing disulfide bonds.. | |
| Protein Sequence | MLFLNIIKLLLGLFIMNEVKAQNFYDSDPHISELTPKSFDKAIHNTNYTSLVEFYAPWCGHCKKLSSTFRKAAKRLDGVVQVAAVNCDLNKNKALCAKYDVNGFPTLMVFRPPKIDLSKPIDNAKKSFSAHANEVYSGARTLAPIVDFSLSRIRSYVKKFVRIDTLGSLLRKSPKLSVVLFSKQDKISPVYKSIALDWLGKFDFYSISNKKLKQLTDMNPTYEKTPEIFKYLQKVIPEQRQSDKSKLVVFDADKDKFWEYEGNSINKNDISKFLRDTFSITPNEGPFSRRSEYIAYLKTGKKPIKKNHSSSGNKHDEL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 47 | N-linked_Glycosylation | DKAIHNTNYTSLVEF HHHHHCCCCCHHEEE | 43.32 | - | |
| 230 | Acetylation | EKTPEIFKYLQKVIP CCCHHHHHHHHHHCC | 51.19 | 24489116 | |
| 307 | N-linked_Glycosylation | GKKPIKKNHSSSGNK CCCCCCCCCCCCCCC | 34.96 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MPD1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MPD1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MPD1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| LCF1_YEAST | FAA1 | genetic | 16269340 | |
| PMT3_YEAST | PMT3 | genetic | 16269340 | |
| USA1_YEAST | USA1 | physical | 18719252 | |
| MPS3_YEAST | MPS3 | physical | 18719252 | |
| JEM1_YEAST | JEM1 | genetic | 19325107 | |
| SIL1_YEAST | SIL1 | genetic | 19325107 | |
| PRP9_YEAST | PRP9 | genetic | 27708008 | |
| TAD3_YEAST | TAD3 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
