| UniProt ID | ECM34_YEAST | |
|---|---|---|
| UniProt AC | P38728 | |
| Protein Name | Protein ECM34 | |
| Gene Name | ECM34 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 170 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
| Protein Description | May be involved in cell wall organization and biogenesis.. | |
| Protein Sequence | MEGRKSEDEKNEAALACDVFESSNAKLPKNVFRSSFTWYCYEVINRSAFHIWLLLCLTLIVGWKVFSGIGGRRPSDSNMDGPQTKHKRNPGFLRRHSTIVILVISLAVSFSWEAFKMYRERTFGKQITQFAKEIIKSAPSTDMESWDRVAADFNSYMYENKLWNTEYFFC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 22 | Phosphorylation | LACDVFESSNAKLPK HHHHHHHHCCCCCCC | 19.89 | 28889911 | |
| 23 | Phosphorylation | ACDVFESSNAKLPKN HHHHHHHCCCCCCCC | 33.34 | 28889911 | |
| 45 | N-linked_Glycosylation | WYCYEVINRSAFHIW HHHHHHHCHHHHHHH | 36.71 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ECM34_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ECM34_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ECM34_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CDC1_YEAST | CDC1 | genetic | 27708008 | |
| MOB2_YEAST | MOB2 | genetic | 27708008 | |
| CDC24_YEAST | CDC24 | genetic | 27708008 | |
| RPAB1_YEAST | RPB5 | genetic | 27708008 | |
| SNU56_YEAST | SNU56 | genetic | 27708008 | |
| GPI19_YEAST | GPI19 | genetic | 27708008 | |
| CCA1_YEAST | CCA1 | genetic | 27708008 | |
| RCC1_YEAST | SRM1 | genetic | 27708008 | |
| TAF1_YEAST | TAF1 | genetic | 27708008 | |
| NDC80_YEAST | NDC80 | genetic | 27708008 | |
| HSP77_YEAST | SSC1 | genetic | 27708008 | |
| SSL1_YEAST | SSL1 | genetic | 27708008 | |
| GSP1_YEAST | GSP1 | genetic | 27708008 | |
| IMB1_YEAST | KAP95 | genetic | 27708008 | |
| RNA1_YEAST | RNA1 | genetic | 27708008 | |
| MED10_YEAST | NUT2 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...