dbPTM

YBU0_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YBU0_YEAST
UniProt AC	P38253
Protein Name	Uncharacterized protein YBR090C
Gene Name	YBR090C
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	122
Subcellular Localization	Cytoplasm . Nucleus . Membrane Single-pass membrane protein .
Protein Description
Protein Sequence	MVPAPGSRAFPSPVFLGGVFFVFFFRWRGNYKVQQVRLRQYWEFTLWETAPNTKQKNDFFAKTLTYIKLALWPQLKKQSNQRNQRRGPPGERRILTPLRGACQLICSLLMKTETLSVPRILT

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of YBU0_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YBU0_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YBU0_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YBU0_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SWI6_YEAST	SWI6	genetic	27708008
ELO2_YEAST	ELO2	genetic	27708008
ODO2_YEAST	KGD2	genetic	27708008
NHP6A_YEAST	NHP6A	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YBU0_YEAST

Related Literatures of Post-Translational Modification