UniProt ID | SDHF4_YEAST | |
---|---|---|
UniProt AC | P38345 | |
Protein Name | Succinate dehydrogenase assembly factor 4, mitochondrial {ECO:0000303|PubMed:24954416} | |
Gene Name | SDH8 {ECO:0000303|PubMed:24954416} | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 138 | |
Subcellular Localization | Mitochondrion matrix . | |
Protein Description | Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Binds to the flavoprotein subunit SDH1 in its FAD-bound form, blocking the generation of excess reactive oxigen species (ROS) and facilitating its assembly with the iron-sulfur protein subunit SDH2 into the SDH catalytic dimer.. | |
Protein Sequence | MLCAIKSTGYRYPRTGALNLLRGRPFNMATRKITTERIPGPPKLPREEQEEFERLQRIATSQEAIDQYNAQATGDRTKESLNSPLLTKNDIGSFSPEFSKTIPEFEGDVNPKTGEVGGPKQDPLRHGDYSFNGRVTDF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
43 | Acetylation | ERIPGPPKLPREEQE CCCCCCCCCCHHHHH | 24489116 | ||
60 | Phosphorylation | ERLQRIATSQEAIDQ HHHHHHHHCHHHHHH | 28889911 | ||
61 | Phosphorylation | RLQRIATSQEAIDQY HHHHHHHCHHHHHHH | 30377154 | ||
77 | Phosphorylation | AQATGDRTKESLNSP HHHHCCCCHHHHCCC | 21126336 | ||
80 | Phosphorylation | TGDRTKESLNSPLLT HCCCCHHHHCCCCCC | 21126336 | ||
83 | Phosphorylation | RTKESLNSPLLTKND CCHHHHCCCCCCCCC | 24909858 | ||
87 | Phosphorylation | SLNSPLLTKNDIGSF HHCCCCCCCCCCCCC | 28889911 | ||
88 | Acetylation | LNSPLLTKNDIGSFS HCCCCCCCCCCCCCC | 24489116 | ||
93 | Phosphorylation | LTKNDIGSFSPEFSK CCCCCCCCCCHHHHC | 28132839 | ||
95 | Phosphorylation | KNDIGSFSPEFSKTI CCCCCCCCHHHHCCC | 21551504 | ||
99 | Phosphorylation | GSFSPEFSKTIPEFE CCCCHHHHCCCCCCC | 28889911 | ||
100 | Acetylation | SFSPEFSKTIPEFEG CCCHHHHCCCCCCCC | 24489116 | ||
130 | Phosphorylation | PLRHGDYSFNGRVTD CCCCCCCCCCCCCCC | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SDHF4_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SDHF4_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SDHF4_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FUMH_YEAST | FUM1 | genetic | 27708008 | |
RS8A_YEAST | RPS8A | genetic | 27708008 | |
RS8B_YEAST | RPS8A | genetic | 27708008 | |
GPR1_YEAST | GPR1 | genetic | 27708008 | |
SAC3_YEAST | SAC3 | genetic | 27708008 | |
ASK10_YEAST | ASK10 | genetic | 27708008 | |
YOR1_YEAST | YOR1 | genetic | 27708008 | |
IF4A_YEAST | TIF2 | genetic | 27708008 | |
ACE2_YEAST | ACE2 | genetic | 27708008 | |
INO4_YEAST | INO4 | genetic | 27708008 | |
DIA2_YEAST | DIA2 | genetic | 27708008 | |
COQ7_YEAST | CAT5 | genetic | 27708008 | |
PDE2_YEAST | PDE2 | genetic | 27708008 | |
UBA3_YEAST | UBA3 | genetic | 27708008 | |
SDHA_YEAST | SDH1 | physical | 24954416 | |
AP1_YEAST | YAP1 | genetic | 24954416 | |
SDHA_YEAST | SDH1 | genetic | 24954416 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...