| UniProt ID | RAD33_YEAST | |
|---|---|---|
| UniProt AC | Q04231 | |
| Protein Name | DNA repair protein RAD33 | |
| Gene Name | RAD33 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 177 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Involved in nucleotide excision repair (NER) of damaged DNA. Required for the repair of RNA polymerase I-transcribed rDNA and RNA polymerase II-transcribed DNA regions. May have a role in stabilizing the DNA repair proteins RAD4 and RAD34.. | |
| Protein Sequence | MSKSTNVSYERVELFENPKVPIEVEDEILEKYAESSLDHDMTVNELPRFFKDLQLEPTIWKLVRNEDVIIEGTDVIDFTKLVRCTCQLLILMNNLTVIDDLWSMLIRNCGRDVDFPQVALRDHVLSVKDLQKISNLIGADQSSGTIEMISCATDGKRLFMTYLDFGCVLGKLGYLKM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSKSTNVSY ------CCCCCCCCC | 35.00 | 22814378 | |
| 19 | Ubiquitination | VELFENPKVPIEVED EECCCCCCCCCEECH | 72.69 | 23749301 | |
| 51 | Ubiquitination | NELPRFFKDLQLEPT HHHHHHHHHCCCCHH | 55.61 | 23749301 | |
| 61 | Ubiquitination | QLEPTIWKLVRNEDV CCCHHHHHHHCCCCE | 33.00 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAD33_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAD33_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAD33_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RV161_YEAST | RVS161 | physical | 16554755 | |
| EF2_YEAST | EFT2 | physical | 16554755 | |
| RV167_YEAST | RVS167 | physical | 16554755 | |
| RAD4_YEAST | RAD4 | physical | 16554755 | |
| MLC1_YEAST | MLC1 | physical | 16554755 | |
| CORO_YEAST | CRN1 | physical | 16554755 | |
| LSB3_YEAST | LSB3 | physical | 16554755 | |
| SERB_YEAST | SER2 | genetic | 17314980 | |
| HTL1_YEAST | HTL1 | genetic | 17314980 | |
| RAD23_YEAST | RAD23 | genetic | 17314980 | |
| PCNA_YEAST | POL30 | genetic | 17314980 | |
| ARD1_YEAST | ARD1 | genetic | 17314980 | |
| SIZ2_YEAST | NFI1 | genetic | 21968059 | |
| SIZ1_YEAST | SIZ1 | genetic | 21968059 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
