| UniProt ID | HTL1_YEAST | |
|---|---|---|
| UniProt AC | Q9URQ5 | |
| Protein Name | High temperature lethal protein 1 | |
| Gene Name | HTL1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 78 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Required for cell cycle progression through G2/M transition at temperatures higher than 33 degrees Celsius. Component of the chromatin structure-remodeling complex (RSC), which is involved in transcription regulation and nucleosome positioning. RSC is responsible for the transfer of a histone octamer from a nucleosome core particle to naked DNA. The reaction requires ATP and involves an activated RSC-nucleosome intermediate. Remodeling reaction also involves DNA translocation, DNA twist and conformational change. As a reconfigurer of centromeric and flanking nucleosomes, RSC complex is required both for proper kinetochore function in chromosome segregation and, via a PKC1-dependent signaling pathway, for organization of the cellular cytoskeleton. When associated with the RSC complex, may act coordinately with PKC1 to regulate G2/M transition. Together with LDB7, NPL6, RSC3, RSC30 components, defines a fungal-specific module within the RSC complex that plays a role in many cellular functions including the maintenance of cell wall integrity.. | |
| Protein Sequence | MSQNNTISSMNPERAYNNVTLKNLTAFQLLSQRENICELLNLVESTERHNSIINPERQRMSLEEMKKMLDALKNERKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSQNNTISS ------CCCCCCCCC | 41.43 | 22814378 | |
| 2 | Phosphorylation | ------MSQNNTISS ------CCCCCCCCC | 41.43 | 24909858 | |
| 6 | Phosphorylation | --MSQNNTISSMNPE --CCCCCCCCCCCHH | 29.77 | 30377154 | |
| 22 | Ubiquitination | AYNNVTLKNLTAFQL HHCCCCCCHHHHHHH | 40.31 | 23749301 | |
| 51 | Phosphorylation | ESTERHNSIINPERQ HHHHHHHCCCCHHHH | 20.79 | 30377154 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HTL1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HTL1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HTL1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...