UniProt ID | ARPC5_YEAST | |
---|---|---|
UniProt AC | P40518 | |
Protein Name | Actin-related protein 2/3 complex subunit 5 | |
Gene Name | ARC15 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 154 | |
Subcellular Localization | Cytoplasm, cytoskeleton, actin patch . | |
Protein Description | Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.. | |
Protein Sequence | MEADWRRIDIDAFDPESGRLTAADLVPPYETTVTLQELQPRMNQLRSLATSGDSLGAVQLLTTDPPYSADAPTKEQYFKSVLEALTQVRQADIGNVIKNLSDSQRDVLVKYLYKGMSVPQGQKQGGVLLAWLERITQVSGVTPIVHYISDRRTV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
79 | Acetylation | PTKEQYFKSVLEALT CCHHHHHHHHHHHHH | 34.42 | 24489116 | |
98 | Acetylation | ADIGNVIKNLSDSQR CHHHHHHHHCCHHHH | 47.77 | 24489116 | |
142 | Phosphorylation | ITQVSGVTPIVHYIS HHHHCCCCCCEEHHC | 15.72 | 23749301 | |
147 | Phosphorylation | GVTPIVHYISDRRTV CCCCCEEHHCCCCCC | 7.39 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARPC5_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARPC5_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARPC5_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-142, AND MASSSPECTROMETRY. |