UniProt ID | YP153_YEAST | |
---|---|---|
UniProt AC | Q06537 | |
Protein Name | Uncharacterized protein YPR153W | |
Gene Name | YPR153W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 140 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MRSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVTAGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCCAVVQILFDVVLSYSMVGSVM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
27 | N-linked_Glycosylation | PSLYWPINNSKYNTA CCCEEECCCCCCCEE | 42.52 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YP153_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YP153_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YP153_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HPH1_YEAST | FRT1 | physical | 18719252 | |
BUD31_YEAST | BUD31 | genetic | 27708008 | |
ATC3_YEAST | DRS2 | genetic | 27708008 | |
RFS1_YEAST | RFS1 | genetic | 27708008 | |
ADPP_YEAST | YSA1 | genetic | 27708008 | |
RU1A_YEAST | MUD1 | genetic | 27708008 | |
RV161_YEAST | RVS161 | genetic | 27708008 | |
BRE1_YEAST | BRE1 | genetic | 27708008 | |
SWF1_YEAST | SWF1 | genetic | 27708008 | |
ARO1_YEAST | ARO1 | genetic | 27708008 | |
RPA14_YEAST | RPA14 | genetic | 27708008 | |
RV167_YEAST | RVS167 | genetic | 27708008 | |
AROC_YEAST | ARO2 | genetic | 27708008 | |
DSD1_YEAST | DSD1 | genetic | 27708008 | |
YG5B_YEAST | YGR250C | genetic | 27708008 | |
HPM1_YEAST | HPM1 | genetic | 27708008 | |
MDV1_YEAST | MDV1 | genetic | 27708008 | |
VPS35_YEAST | VPS35 | genetic | 27708008 | |
YJY1_YEAST | YJR011C | genetic | 27708008 | |
DBP7_YEAST | DBP7 | genetic | 27708008 | |
ERG3_YEAST | ERG3 | genetic | 27708008 | |
SWI6_YEAST | SWI6 | genetic | 27708008 | |
VRP1_YEAST | VRP1 | genetic | 27708008 | |
ERG6_YEAST | ERG6 | genetic | 27708008 | |
AIM34_YEAST | AIM34 | genetic | 27708008 | |
PKR1_YEAST | PKR1 | genetic | 27708008 | |
SSO2_YEAST | SSO2 | genetic | 27708008 | |
MRE11_YEAST | MRE11 | genetic | 27708008 | |
SUR1_YEAST | SUR1 | genetic | 27708008 | |
FATE1_HUMAN | FATE1 | physical | 27107014 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...