| UniProt ID | YP153_YEAST | |
|---|---|---|
| UniProt AC | Q06537 | |
| Protein Name | Uncharacterized protein YPR153W | |
| Gene Name | YPR153W | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 140 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MRSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVTAGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCCAVVQILFDVVLSYSMVGSVM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 27 | N-linked_Glycosylation | PSLYWPINNSKYNTA CCCEEECCCCCCCEE | 42.52 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YP153_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YP153_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YP153_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| HPH1_YEAST | FRT1 | physical | 18719252 | |
| BUD31_YEAST | BUD31 | genetic | 27708008 | |
| ATC3_YEAST | DRS2 | genetic | 27708008 | |
| RFS1_YEAST | RFS1 | genetic | 27708008 | |
| ADPP_YEAST | YSA1 | genetic | 27708008 | |
| RU1A_YEAST | MUD1 | genetic | 27708008 | |
| RV161_YEAST | RVS161 | genetic | 27708008 | |
| BRE1_YEAST | BRE1 | genetic | 27708008 | |
| SWF1_YEAST | SWF1 | genetic | 27708008 | |
| ARO1_YEAST | ARO1 | genetic | 27708008 | |
| RPA14_YEAST | RPA14 | genetic | 27708008 | |
| RV167_YEAST | RVS167 | genetic | 27708008 | |
| AROC_YEAST | ARO2 | genetic | 27708008 | |
| DSD1_YEAST | DSD1 | genetic | 27708008 | |
| YG5B_YEAST | YGR250C | genetic | 27708008 | |
| HPM1_YEAST | HPM1 | genetic | 27708008 | |
| MDV1_YEAST | MDV1 | genetic | 27708008 | |
| VPS35_YEAST | VPS35 | genetic | 27708008 | |
| YJY1_YEAST | YJR011C | genetic | 27708008 | |
| DBP7_YEAST | DBP7 | genetic | 27708008 | |
| ERG3_YEAST | ERG3 | genetic | 27708008 | |
| SWI6_YEAST | SWI6 | genetic | 27708008 | |
| VRP1_YEAST | VRP1 | genetic | 27708008 | |
| ERG6_YEAST | ERG6 | genetic | 27708008 | |
| AIM34_YEAST | AIM34 | genetic | 27708008 | |
| PKR1_YEAST | PKR1 | genetic | 27708008 | |
| SSO2_YEAST | SSO2 | genetic | 27708008 | |
| MRE11_YEAST | MRE11 | genetic | 27708008 | |
| SUR1_YEAST | SUR1 | genetic | 27708008 | |
| FATE1_HUMAN | FATE1 | physical | 27107014 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...