UniProt ID | RFS1_YEAST | |
---|---|---|
UniProt AC | P38234 | |
Protein Name | Protein RFS1 | |
Gene Name | RFS1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 210 | |
Subcellular Localization | Cytoplasm . Membrane raft . | |
Protein Description | ||
Protein Sequence | MPKVAILIYSVDDIIATLAENEKKGIEIAGGEAEIFQVPDVSYKTEYATEEGKEAAKVAKTNADFSYKILTRETLVEYDYYLFGIPTKFGNFPAEWKSFWDSNTGGLWAKGSLHGKIAGLFVSGAISGKGDTEMCIMNAMSTLVHHGVIYVPLGYKNAYKELTDVEDVNGSCAWGAGCVSGIDGGRPPSLSELRVHQLQGKAFYDRIKDL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
53 | Ubiquitination | EYATEEGKEAAKVAK EEECHHHHHHHHHHH | 47.67 | 23749301 | |
57 | Ubiquitination | EEGKEAAKVAKTNAD HHHHHHHHHHHHCCC | 50.18 | 22817900 | |
60 | Ubiquitination | KEAAKVAKTNADFSY HHHHHHHHHCCCCCE | 45.35 | 23749301 | |
60 | 2-Hydroxyisobutyrylation | KEAAKVAKTNADFSY HHHHHHHHHCCCCCE | 45.35 | - | |
68 | Acetylation | TNADFSYKILTRETL HCCCCCEEECCCHHH | 30.00 | 24489116 | |
110 | Acetylation | NTGGLWAKGSLHGKI CCCCEEECCCCCCEE | 37.13 | 24489116 | |
123 | Phosphorylation | KIAGLFVSGAISGKG EEEEEEECCCCCCCC | 18.38 | 19823750 | |
127 | Phosphorylation | LFVSGAISGKGDTEM EEECCCCCCCCCHHH | 33.64 | 19823750 | |
201 | Ubiquitination | RVHQLQGKAFYDRIK HHHHHCCHHHHHHHH | 23.51 | 23749301 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RFS1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RFS1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RFS1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...