| UniProt ID | PST2_YEAST | |
|---|---|---|
| UniProt AC | Q12335 | |
| Protein Name | Protoplast secreted protein 2 | |
| Gene Name | PST2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 198 | |
| Subcellular Localization | Secreted. | |
| Protein Description | ||
| Protein Sequence | MPRVAIIIYTLYGHVAATAEAEKKGIEAAGGSADIYQVEETLSPEVVKALGGAPKPDYPIATQDTLTEYDAFLFGIPTRFGNFPAQWKAFWDRTGGLWAKGALHGKVAGCFVSTGTGGGNEATIMNSLSTLAHHGIIFVPLGYKNVFAELTNMDEVHGGSPWGAGTIAGSDGSRSPSALELQVHEIQGKTFYETVAKF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 24 | Acetylation | ATAEAEKKGIEAAGG HHHHHHHHCHHHCCC | 57.54 | 24489116 | |
| 32 | Phosphorylation | GIEAAGGSADIYQVE CHHHCCCCCCEEEEE | 23.11 | 21126336 | |
| 41 | Phosphorylation | DIYQVEETLSPEVVK CEEEEEECCCHHHHH | 21.01 | 24961812 | |
| 43 | Phosphorylation | YQVEETLSPEVVKAL EEEEECCCHHHHHHH | 26.83 | 24961812 | |
| 88 | Ubiquitination | GNFPAQWKAFWDRTG CCCCHHHHHHHHHCC | 22.94 | 23749301 | |
| 100 | Ubiquitination | RTGGLWAKGALHGKV HCCCCEECCCCCCEE | 32.89 | 23749301 | |
| 100 | Acetylation | RTGGLWAKGALHGKV HCCCCEECCCCCCEE | 32.89 | 24489116 | |
| 173 | Phosphorylation | TIAGSDGSRSPSALE EECCCCCCCCCCCEE | 34.28 | 21440633 | |
| 175 | Phosphorylation | AGSDGSRSPSALELQ CCCCCCCCCCCEEEE | 25.55 | 20377248 | |
| 177 | Phosphorylation | SDGSRSPSALELQVH CCCCCCCCCEEEEEE | 46.89 | 17330950 | |
| 189 | Ubiquitination | QVHEIQGKTFYETVA EEEEECCCCHHHHHH | 21.05 | 24961812 | |
| 189 | Acetylation | QVHEIQGKTFYETVA EEEEECCCCHHHHHH | 21.05 | 24489116 | |
| 197 | Ubiquitination | TFYETVAKF------ CHHHHHHCC------ | 47.47 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PST2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PST2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PST2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...