| UniProt ID | YGK8_YEAST | |
|---|---|---|
| UniProt AC | P53139 | |
| Protein Name | Uncharacterized protein YGL108C | |
| Gene Name | YGL108C | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 140 | |
| Subcellular Localization |
Cell membrane Lipid-anchor . |
|
| Protein Description | ||
| Protein Sequence | MGLCGSKTQPMPSQTTTVATKARTKPINRDTVKSKQELRHKEKKDKKKKTQLKSTTVPVVQRKEGSKLTDTSDPSKNKVSPKEAARLAAEKRFQETNEKYNKGELGKKLAQERAKSHKTRLMEEAEKKHAERERENMIYD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Myristoylation | ------MGLCGSKTQ ------CCCCCCCCC | 29.67 | 19416974 | |
| 4 | S-palmitoylation | ----MGLCGSKTQPM ----CCCCCCCCCCC | 4.85 | 19416974 | |
| 66 | Phosphorylation | VVQRKEGSKLTDTSD EEECCCCCCCCCCCC | 26.11 | 30377154 | |
| 69 | Phosphorylation | RKEGSKLTDTSDPSK CCCCCCCCCCCCCCC | 40.75 | 30377154 | |
| 72 | Phosphorylation | GSKLTDTSDPSKNKV CCCCCCCCCCCCCCC | 50.78 | 27017623 | |
| 76 | Ubiquitination | TDTSDPSKNKVSPKE CCCCCCCCCCCCHHH | 67.20 | 23749301 | |
| 127 | Acetylation | RLMEEAEKKHAERER HHHHHHHHHHHHHHH | 57.83 | 25381059 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YGK8_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YGK8_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YGK8_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CDC48_YEAST | CDC48 | physical | 16554755 | |
| MUP1_YEAST | MUP1 | physical | 18467557 | |
| SFK1_YEAST | SFK1 | physical | 18467557 | |
| MID2_YEAST | MID2 | physical | 18467557 | |
| WSC2_YEAST | WSC2 | physical | 18467557 | |
| CDC48_YEAST | CDC48 | physical | 18719252 | |
| URA7_YEAST | URA7 | genetic | 27708008 | |
| NPL4_YEAST | NPL4 | genetic | 27708008 | |
| RMD9L_YEAST | YBR238C | genetic | 27708008 | |
| RIM1_YEAST | RIM1 | genetic | 27708008 | |
| UME6_YEAST | UME6 | genetic | 27708008 | |
| BCS1_YEAST | BCS1 | genetic | 27708008 | |
| CBP4_YEAST | CBP4 | genetic | 27708008 | |
| DAL81_YEAST | DAL81 | genetic | 27708008 | |
| PET20_YEAST | PET20 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...