UniProt ID | FATE1_HUMAN | |
---|---|---|
UniProt AC | Q969F0 | |
Protein Name | Fetal and adult testis-expressed transcript protein | |
Gene Name | FATE1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 183 | |
Subcellular Localization |
Mitochondrion . Mitochondrion outer membrane . Endoplasmic reticulum membrane Single-pass membrane protein Cytoplasmic side . Localized to specific membrane structures termed mitochondria-associated membranes (MAMs) which connect the endoplasmic |
|
Protein Description | Involved in the regulation of endoplasmic reticulum (ER)-mitochondria coupling. Negatively regulates the ER-mitochondria distance and Ca(2+) transfer from ER to mitochondria possibly implicating it in the regulation of apoptosis. [PubMed: 27402544 May collaborate with RNF183 to restrain BIK protein levels thus regulating apoptotic signaling] | |
Protein Sequence | MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAGSASAKRVWNMTATRPKKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQLYAVNRRLRALEEQGATWRHRETLIIAVLVSASIANLWLWMNQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of FATE1_HUMAN !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FATE1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FATE1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FATE1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RN183_HUMAN | RNF183 | physical | 16189514 | |
SNP47_HUMAN | SNAP47 | physical | 25416956 | |
SYNPR_HUMAN | SYNPR | physical | 25416956 | |
NRSN1_HUMAN | NRSN1 | physical | 25416956 | |
NRG4_HUMAN | NRG4 | physical | 25416956 | |
KASH5_HUMAN | CCDC155 | physical | 25416956 | |
TMM74_HUMAN | TMEM74 | physical | 25416956 | |
SYNE4_HUMAN | SYNE4 | physical | 25416956 | |
SNG2_HUMAN | SYNGR2 | physical | 21516116 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...