| UniProt ID | FATE1_HUMAN | |
|---|---|---|
| UniProt AC | Q969F0 | |
| Protein Name | Fetal and adult testis-expressed transcript protein | |
| Gene Name | FATE1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 183 | |
| Subcellular Localization |
Mitochondrion . Mitochondrion outer membrane . Endoplasmic reticulum membrane Single-pass membrane protein Cytoplasmic side . Localized to specific membrane structures termed mitochondria-associated membranes (MAMs) which connect the endoplasmic |
|
| Protein Description | Involved in the regulation of endoplasmic reticulum (ER)-mitochondria coupling. Negatively regulates the ER-mitochondria distance and Ca(2+) transfer from ER to mitochondria possibly implicating it in the regulation of apoptosis. [PubMed: 27402544 May collaborate with RNF183 to restrain BIK protein levels thus regulating apoptotic signaling] | |
| Protein Sequence | MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAGSASAKRVWNMTATRPKKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQLYAVNRRLRALEEQGATWRHRETLIIAVLVSASIANLWLWMNQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of FATE1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FATE1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FATE1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FATE1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RN183_HUMAN | RNF183 | physical | 16189514 | |
| SNP47_HUMAN | SNAP47 | physical | 25416956 | |
| SYNPR_HUMAN | SYNPR | physical | 25416956 | |
| NRSN1_HUMAN | NRSN1 | physical | 25416956 | |
| NRG4_HUMAN | NRG4 | physical | 25416956 | |
| KASH5_HUMAN | CCDC155 | physical | 25416956 | |
| TMM74_HUMAN | TMEM74 | physical | 25416956 | |
| SYNE4_HUMAN | SYNE4 | physical | 25416956 | |
| SNG2_HUMAN | SYNGR2 | physical | 21516116 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
