| UniProt ID | SNG2_HUMAN | |
|---|---|---|
| UniProt AC | O43760 | |
| Protein Name | Synaptogyrin-2 {ECO:0000305} | |
| Gene Name | SYNGR2 {ECO:0000312|HGNC:HGNC:11499} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 224 | |
| Subcellular Localization |
Cytoplasmic vesicle membrane Multi-pass membrane protein . Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane Multi-pass membrane protein . Localizes to cytoplasmic vesicles associated with the recycling endosomes. Lipid droplet. |
|
| Protein Description | May play a role in regulated exocytosis. In neuronal cells, modulates the localization of synaptophysin/SYP into synaptic-like microvesicles and may therefore play a role in the formation and/or the maturation of this vesicles. May also play a role in GLUT4 storage and transport to the plasma membrane.; (Microbial infection) May play a role in the assembly of cytoplasmic inclusion bodies required for SFTS phlebovirus replication.. | |
| Protein Sequence | MESGAYGAAKAGGSFDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNAHESKQMYCVFNRNEDACRYGSAIGVLAFLASAFFLVVDAYFPQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAVTNPKDVLVGADSVRAAITFSFFSIFSWGVLASLAYQRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQPPPVY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MESGAYGA -------CCCCCCCC | 9.26 | 22223895 | |
| 3 | Phosphorylation | -----MESGAYGAAK -----CCCCCCCCHH | 27.68 | 23401153 | |
| 6 | Phosphorylation | --MESGAYGAAKAGG --CCCCCCCCHHCCC | 15.72 | 27259358 | |
| 10 | Ubiquitination | SGAYGAAKAGGSFDL CCCCCCHHCCCCCCH | 47.21 | 21890473 | |
| 14 | Phosphorylation | GAAKAGGSFDLRRFL CCHHCCCCCCHHHHH | 18.05 | 25850435 | |
| 181 | Phosphorylation | VDDFIQNYVDPTPDP HHHHHHHCCCCCCCC | 7.00 | - | |
| 194 | Phosphorylation | DPNTAYASYPGASVD CCCCCCCCCCCCCCC | 21.13 | - | |
| 203 | Phosphorylation | PGASVDNYQQPPFTQ CCCCCCCCCCCCCCC | 12.22 | 22817900 | |
| 218 | Phosphorylation | NAETTEGYQPPPVY- CCCCCCCCCCCCCC- | 16.18 | 22817900 | |
| 224 | Phosphorylation | GYQPPPVY------- CCCCCCCC------- | 20.71 | 20736484 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SNG2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SNG2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SNG2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SCAR3_HUMAN | SCARA3 | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, PHOSPHORYLATION [LARGESCALE ANALYSIS] AT SER-3, AND MASS SPECTROMETRY. | |
| Phosphorylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, PHOSPHORYLATION [LARGESCALE ANALYSIS] AT SER-3, AND MASS SPECTROMETRY. | |