dbPTM

NRSN1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NRSN1_HUMAN
UniProt AC	Q8IZ57
Protein Name	Neurensin-1
Gene Name	NRSN1 {ECO:0000312\|HGNC:HGNC:17881}
Organism	Homo sapiens (Human).
Sequence Length	195
Subcellular Localization	Membrane Multi-pass membrane protein . Localizes mainly to neurites.
Protein Description	May play an important role in neural organelle transport, and in transduction of nerve signals or in nerve growth. May play a role in neurite extension. May play a role in memory consolidation (By similarity)..
Protein Sequence	MSSCSNVCGSRQAQAAAEGGYQRYGVRSYLHQFYEDCTASIWEYEDDFQIQRSPNRWSSVFWKVGLISGTVFVILGLTVLAVGFLVPPKIEAFGEADFVVVDTHAVQFNSALDMYKLAGAVLFCIGGTSMAGCLLMSVFVKSYSKEEKFLQQKFKERIADIKAHTQPVTKAPGPGETKIPVTLSRVQNVQPLLAT

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
53	Phosphorylation	DDFQIQRSPNRWSSV CCCEECCCCCCHHHH	15.34	26074081
58	Phosphorylation	QRSPNRWSSVFWKVG CCCCCCHHHHHHHHH	17.24	26074081
59	Phosphorylation	RSPNRWSSVFWKVGL CCCCCHHHHHHHHHH	17.86	26074081
153	Ubiquitination	EEKFLQQKFKERIAD HHHHHHHHHHHHHHH	45.50	-
162	Ubiquitination	KERIADIKAHTQPVT HHHHHHHHHHCCCCC	34.36	30230243
170	Ubiquitination	AHTQPVTKAPGPGET HHCCCCCCCCCCCCC	53.47	30230243
178	Ubiquitination	APGPGETKIPVTLSR CCCCCCCCCCEEHHH	40.48	30230243

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NRSN1_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NRSN1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NRSN1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of NRSN1_HUMAN !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NRSN1_HUMAN

Related Literatures of Post-Translational Modification