RN183_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RN183_HUMAN
• UniProt AC: Q96D59
• Protein Name: Probable E3 ubiquitin-protein ligase RNF183
• Gene Name: RNF183
• Organism: Homo sapiens (Human).
• Sequence Length: 192
• Subcellular Localization: Membrane ; Single-pass membrane protein . Endoplasmic reticulum .
• Protein Description: May act as a E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. May collaborate with FATE1 to restrain BIK protein levels thus regulating apoptotic signaling. [PubMed: 26567849]
• Protein Sequence: MAEQQGRELEAECPVCWNPFNNTFHTPKMLDCCHSFCVECLAHLSLVTPARRRLLCPLCRQPTVLASGQPVTDLPTDTAMLALLRLEPHHVILEGHQLCLKDQPKSRYFLRQPQVYTLDLGPQPGGQTGPPPDTASATVSTPILIPSHHSLRECFRNPQFRIFAYLMAVILSVTLLLIFSIFWTKQFLWGVG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of RN183_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RN183_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RN183_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RN183_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049
IKBA_HUMAN	NFKBIA	physical	26818663

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.