NRG4_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NRG4_HUMAN
• UniProt AC: Q8WWG1
• Protein Name: Pro-neuregulin-4, membrane-bound isoform
• Gene Name: NRG4
• Organism: Homo sapiens (Human).
• Sequence Length: 115
• Subcellular Localization: Pro-neuregulin-4, membrane-bound isoform: Cell membrane; Single-pass type I membrane protein. Does not seem to be active..; Neuregulin-4: Secreted.
• Protein Description: Low affinity ligand for the ERBB4 tyrosine kinase receptor. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. Does not bind to the ERBB1, ERBB2 and ERBB3 receptors (By similarity)..
• Protein Sequence: MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
39	N-linked_Glycosylation	PFCRCVENYTGARCE CHHHHHHHCCCCCEE	21.19	UniProtKB CARBOHYD

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NRG4_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NRG4_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NRG4_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FATE1_HUMAN	FATE1	physical	21516116

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.