dbPTM

DSD1_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DSD1_YEAST
UniProt AC	P53095
Protein Name	D-serine dehydratase
Gene Name	DSD1
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	428
Subcellular Localization
Protein Description	Converts specifically D-serine to pyruvate and ammonia. May play a role in D-serine detoxification..
Protein Sequence	MSDVLSQYKGCSVRDLPTPNFVINEEKFDKNCTTMLNNVEKLSQECGVPIKFRAHVKTHKTAKGTLKQLGHGLPLAKRTTRAILVSTLKEAEELLNYQDRQCSDYIDDITYSLPCCVPEFIPLLSNLSRRVNNFQVFVDNIEHLENLKNFGRPASGKKWSVFIKVDMGTKRAGLAFDSPEFLSLLKKLTSSEIKEVIEPYGFYAHAGHSYSSTSINDTQNLLMEEVKAVNSAAKVLCSVDPQFDPSKLTLSVGATPTSNSLKLDNKSTLVKFITTQLVSTLEIHCGNYCMYDLQQVATGCVQDHELSGFVLGTVLSSYPSRGELLSNTGVMCLTREASSIKGFGICADLEHVLKSESFSREWYVARVSQEHGILRPIRNWNETTPLKLGSKIAVLPQHACITMGQFPYYFVVNSEGIVNDVWLPFQKW

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MSDVLSQYKGCSV --CCHHHHHCCCCCC	31.17	28889911
12	Phosphorylation	LSQYKGCSVRDLPTP HHHCCCCCCCCCCCC	28.93	29136822
18	Phosphorylation	CSVRDLPTPNFVINE CCCCCCCCCCEEECH	37.86	29136822

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DSD1_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DSD1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DSD1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AGC1_YEAST	AGC1	genetic	27708008
SCS22_YEAST	SCS22	genetic	27708008
H4_YEAST	HHF1	genetic	27708008
IST2_YEAST	IST2	genetic	27708008
RV167_YEAST	RVS167	genetic	27708008
DRN1_YEAST	DRN1	genetic	27708008
SNA3_YEAST	SNA3	genetic	27708008
UBA3_YEAST	UBA3	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DSD1_YEAST

Related Literatures of Post-Translational Modification