| UniProt ID | SCS22_YEAST | |
|---|---|---|
| UniProt AC | Q6Q595 | |
| Protein Name | Vesicle-associated membrane protein-associated protein SCS22 | |
| Gene Name | SCS22 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 175 | |
| Subcellular Localization |
Membrane Single-pass type IV membrane protein . |
|
| Protein Description | Targets proteins containing a FFAT motif to membranes (By similarity). Involved in regulation of phospholipid metabolism.. | |
| Protein Sequence | MRIVPEKLVFKAPLNKQSTEYIKLENDGEKRVIFKVRTSAPTKYCVRPNVAIIGAHESVNVQIVFLGLPKSTADDEMDQKRDKFLIVTLPIPAAYQNVEDGELLSDWPNLEEQYKDDIVFKKIKIFHSVLPKRKPSGNHDAESARAPSAGNGQSLSSRALLIITVIALLVGWIYY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Acetylation | -MRIVPEKLVFKAPL -CCCCCCCEEEECCC | 43.83 | 24489116 | |
| 124 | Acetylation | DIVFKKIKIFHSVLP CCHHEEEEEHHHCCC | 48.47 | 24489116 | |
| 136 | Phosphorylation | VLPKRKPSGNHDAES CCCCCCCCCCCCHHH | 56.09 | 30377154 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SCS22_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SCS22_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SCS22_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...