dbPTM

AIM29_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	AIM29_YEAST
UniProt AC	P36154
Protein Name	Altered inheritance rate of mitochondria protein 29
Gene Name	AIM29
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	155
Subcellular Localization	Cytoplasm .
Protein Description	May be involved in mitochondrial organization and biogenesis..
Protein Sequence	MNSTKRLKMSTTFHDYDLEEPLTSNARPLKNSVITIRVIKSFPYRNVKNIVLHDYDLADKTAKDLFNDVLNKIQNEGSFRPFRNVKFDTLKIYTHAHGSKTVNLVINFDHDDDWTLDIENDKKKLFEYGIENETEISLFNKEDYLRFKENPEEKW

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
10	Phosphorylation	STKRLKMSTTFHDYD CCCCEEEECCCCCCC	23.78	21440633
11	Phosphorylation	TKRLKMSTTFHDYDL CCCEEEECCCCCCCC	29.95	21440633
12	Phosphorylation	KRLKMSTTFHDYDLE CCEEEECCCCCCCCC	16.21	20377248
24	Phosphorylation	DLEEPLTSNARPLKN CCCCCCCCCCCCCCC	35.85	19779198
40	Acetylation	VITIRVIKSFPYRNV EEEEEEEECCCCCCE	43.09	22865919
78	Phosphorylation	NKIQNEGSFRPFRNV HHHHCCCCCCCCCCC	16.35	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of AIM29_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of AIM29_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of AIM29_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ACT_YEAST	ACT1	genetic	27708008
MRM2_YEAST	MRM2	genetic	27708008
ASK10_YEAST	ASK10	genetic	27708008
CDK1_YEAST	CDC28	genetic	27708008
MED8_YEAST	MED8	genetic	27708008
PRP9_YEAST	PRP9	genetic	27708008
PRP11_YEAST	PRP11	genetic	27708008
DOP1_YEAST	DOP1	genetic	27708008
GPI8_YEAST	GPI8	genetic	27708008
GDI1_YEAST	GDI1	genetic	27708008
COG3_YEAST	COG3	genetic	27708008
CDC4_YEAST	CDC4	genetic	27708008
MOB2_YEAST	MOB2	genetic	27708008
SAD1_YEAST	SAD1	genetic	27708008
RSC8_YEAST	RSC8	genetic	27708008
MCE1_YEAST	CEG1	genetic	27708008
PTI1_YEAST	PTI1	genetic	27708008
CDC12_YEAST	CDC12	genetic	27708008
SEC22_YEAST	SEC22	genetic	27708008
RU1C_YEAST	YHC1	genetic	27708008
STT4_YEAST	STT4	genetic	27708008
HMCS_YEAST	ERG13	genetic	27708008
CBF3B_YEAST	CEP3	genetic	27708008
FCP1_YEAST	FCP1	genetic	27708008
TYSY_YEAST	CDC21	genetic	27708008
MYO2_YEAST	MYO2	genetic	27708008
PSA7_YEAST	PRE10	genetic	27708008
TBF1_YEAST	TBF1	genetic	27708008
SEC8_YEAST	SEC8	genetic	27708008
RS8A_YEAST	RPS8A	genetic	27708008
RS8B_YEAST	RPS8A	genetic	27708008
UME6_YEAST	UME6	genetic	27708008
RTF1_YEAST	RTF1	genetic	27708008
ERG3_YEAST	ERG3	genetic	27708008
SWI6_YEAST	SWI6	genetic	27708008
NKP2_YEAST	NKP2	genetic	27708008
PKR1_YEAST	PKR1	genetic	27708008
SCS7_YEAST	SCS7	genetic	27708008
TPM1_YEAST	TPM1	genetic	27708008
MED1_YEAST	MED1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of AIM29_YEAST

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-78, AND MASSSPECTROMETRY.	18407956 [Abstract]