TYSY_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TYSY_YEAST
• UniProt AC: P06785
• Protein Name: Thymidylate synthase
• Gene Name: CDC21
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 304
• Subcellular Localization: Nucleus . Localizes to the nuclear periphery.
• Protein Description: Thymidylate synthase required for de novo biosynthesis of pyrimidine deoxyribonucleotides. Required for both nuclear and mitochondrial DNA synthesis..
• Protein Sequence: MTMDGKNKEEEQYLDLCKRIIDEGEFRPDRTGTGTLSLFAPPQLRFSLRDDTFPLLTTKKVFTRGIILELLWFLAGDTDANLLSEQGVKIWDGNGSREYLDKMGFKDRKVGDLGPVYGFQWRHFGAKYKTCDDDYTGQGIDQLKQVIHKLKTNPYDRRIIMSAWNPADFDKMALPPCHIFSQFYVSFPKEGEGSGKPRLSCLLYQRSCDMGLGVPFNIASYALLTRMIAKVVDMEPGEFIHTLGDAHVYKDHIDALKEQITRNPRPFPKLKIKRDVKDIDDFKLTDFEIEDYNPHPRIQMKMSV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
102	Acetylation	GSREYLDKMGFKDRK CCHHHHHHCCCCCCC	38.02	24489116
127	Acetylation	QWRHFGAKYKTCDDD ECCCCCCEEECCCCC	47.89	25381059
144	Acetylation	GQGIDQLKQVIHKLK CCHHHHHHHHHHHHC	36.56	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TYSY_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TYSY_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TYSY_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FIMB_YEAST	SAC6	genetic	10572259
UNG_YEAST	UNG1	genetic	19362086

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.