YO014_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YO014_YEAST
• UniProt AC: Q08110
• Protein Name: Putative uncharacterized protein YOL014W
• Gene Name: YOL014W
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 124
• Protein Sequence: MRPHHFFCGNMGVMYTAMSGYETEDAQAYWACGRAYESAFATLTKKVPGTTFSADMPTSTWHGVLDCGYSSSINVAENKSSPIDYWNCGRTYARNYALSDALSLKPTNMLQYFLLVLFFICIIL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
15	Phosphorylation	CGNMGVMYTAMSGYE CCCCHHHEEECCCCC	6.74	30377154
16	Phosphorylation	GNMGVMYTAMSGYET CCCHHHEEECCCCCC	9.59	30377154
19	Phosphorylation	GVMYTAMSGYETEDA HHHEEECCCCCCHHH	35.44	30377154
29	Phosphorylation	ETEDAQAYWACGRAY CCHHHHHHHHHHHHH	4.97	30377154
96	Phosphorylation	GRTYARNYALSDALS CHHHHHHHHHHHHHC	11.90	30377154
99	Phosphorylation	YARNYALSDALSLKP HHHHHHHHHHHCCCC	16.80	30377154

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YO014_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YO014_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YO014_YEAST !!

Protein-Protein Interaction

Oops, there are no PPI records of YO014_YEAST !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.