| UniProt ID | ARPC1_YEAST | |
|---|---|---|
| UniProt AC | P38328 | |
| Protein Name | Actin-related protein 2/3 complex subunit 1 | |
| Gene Name | ARC40 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 384 | |
| Subcellular Localization | Cytoplasm, cytoskeleton, actin patch. | |
| Protein Description | Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.. | |
| Protein Sequence | MSFSNSKDKSVVAVYKLVKAPIYSHCFSQDKSILAVTCETDCLVYRVSNNTPPVLFATLKDHDKTITAVDISIHGRIVTCSQDRNAYVWEPLSDGTYKPTLVLLRINRAATSVTWAPNGYKFAVGSSARIIAVCYYEHENNWWVSKHIKKPIKSTINCLSWHANGVLLAAGGTDGFMRVFSGFIKGLDSKESVAGSPWGQKFPFGCLIREWYQGSYIHDVEWRSQMERIAYVAHDGTLNVVDYQSPVQSVNAPEGLPYRSLVWINDHEIVCGGYSCHPVLFSEASEGWKFAKNLDKSDNNKSSALTASGNTDELSGNNDESSTFGISALRKFKELDLKGKVSTDVQESAHENAIVELRPFAESNGQITQVSSCGLDGKIVIYTI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSFSNSKDK ------CCCCCCCCC | 37.06 | 27717283 | |
| 19 | Ubiquitination | VAVYKLVKAPIYSHC EEEEEEECCCHHHHH | 59.90 | 23749301 | |
| 60 | Acetylation | PVLFATLKDHDKTIT CEEEEEECCCCCEEE | 48.97 | 24489116 | |
| 98 | Ubiquitination | PLSDGTYKPTLVLLR ECCCCCCCCEEEEEE | 31.22 | 23749301 | |
| 121 | Methylation | TWAPNGYKFAVGSSA EECCCCEEEECCCCC | 28.39 | 20137074 | |
| 185 | Acetylation | RVFSGFIKGLDSKES HHHHHHHCCCCCCCC | 51.68 | 24489116 | |
| 190 | Acetylation | FIKGLDSKESVAGSP HHCCCCCCCCCCCCC | 54.39 | 24489116 | |
| 201 | Acetylation | AGSPWGQKFPFGCLI CCCCCCCCCCCCEEE | 51.58 | 24489116 | |
| 306 | Phosphorylation | NNKSSALTASGNTDE CCCCCCEEECCCCCC | 20.63 | 22369663 | |
| 308 | Phosphorylation | KSSALTASGNTDELS CCCCEEECCCCCCCC | 27.60 | 22369663 | |
| 311 | Phosphorylation | ALTASGNTDELSGNN CEEECCCCCCCCCCC | 34.08 | 22369663 | |
| 315 | Phosphorylation | SGNTDELSGNNDESS CCCCCCCCCCCCCCC | 37.11 | 22369663 | |
| 321 | Phosphorylation | LSGNNDESSTFGISA CCCCCCCCCHHHHHH | 37.23 | 22369663 | |
| 322 | Phosphorylation | SGNNDESSTFGISAL CCCCCCCCHHHHHHH | 26.21 | 22369663 | |
| 323 | Phosphorylation | GNNDESSTFGISALR CCCCCCCHHHHHHHH | 34.85 | 23749301 | |
| 363 | Phosphorylation | ELRPFAESNGQITQV EEEECHHHCCEEEEE | 42.71 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARPC1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARPC1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARPC1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
