dbPTM

AIM7_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	AIM7_YEAST
UniProt AC	Q12156
Protein Name	Protein AIM7
Gene Name	AIM7
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	149
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	May be involved in mitochondrial organization and biogenesis..
Protein Sequence	MSNLYKIGTETRNKIKKFRTSTARTDSIKALSIKIEPKPSYEIIVDEDEQEELDEIEDLSELAEILPDNSPRFVLTAYPTTTKDGFKQTPLVLVYWKPMTVVSQEWKMLYAGALEMIREECGTFKLIEVSSGLEDDSDVEELREQLENC

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSNLYKIGT ------CCCCEECCH	35.23	22814378
11	Phosphorylation	LYKIGTETRNKIKKF CEECCHHHHHHHHHH	39.10	19823750
83	Ubiquitination	TAYPTTTKDGFKQTP EECCEECCCCCCCCC	54.48	23749301
83	Acetylation	TAYPTTTKDGFKQTP EECCEECCCCCCCCC	54.48	24489116
103	Phosphorylation	WKPMTVVSQEWKMLY ECCCEEECHHHHHHH	20.32	30377154
110	Phosphorylation	SQEWKMLYAGALEMI CHHHHHHHHHHHHHH	10.25	28132839
130	Phosphorylation	TFKLIEVSSGLEDDS CEEEEEECCCCCCCC	13.09	22369663
131	Phosphorylation	FKLIEVSSGLEDDSD EEEEEECCCCCCCCC	53.20	22369663
137	Phosphorylation	SSGLEDDSDVEELRE CCCCCCCCCHHHHHH	56.74	22369663

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of AIM7_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of AIM7_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of AIM7_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARPC4_YEAST	ARC19	physical	10688190
DAL80_YEAST	DAL80	physical	18719252
YD124_YEAST	YDR124W	physical	18719252
COFI_YEAST	COF1	genetic	20362448
ARP3_YEAST	ARP3	physical	20362448
ARPC2_YEAST	ARC35	physical	20362448
ACT_YEAST	ACT1	physical	20362448
ARP3_YEAST	ARP3	physical	23727094
ARP2_YEAST	ARP2	physical	23727094
ARPC1_YEAST	ARC40	physical	23727094
ARPC2_YEAST	ARC35	physical	23727094
NDH2_YEAST	NDE2	genetic	27708008
YO292_YEAST	YOR292C	genetic	27708008
CDC24_YEAST	CDC24	genetic	27708008
ACT_YEAST	ACT1	genetic	27708008
SWC4_YEAST	SWC4	genetic	27708008
DPOD2_YEAST	POL31	genetic	27708008
SEC22_YEAST	SEC22	genetic	27708008
PROF_YEAST	PFY1	genetic	27708008
RS8A_YEAST	RPS8A	genetic	27708008
RS8B_YEAST	RPS8A	genetic	27708008
QOR_YEAST	ZTA1	genetic	27708008
NPL4_YEAST	NPL4	genetic	27708008
AIM4_YEAST	AIM4	genetic	27708008
CLPX_YEAST	MCX1	genetic	27708008
AGP1_YEAST	AGP1	genetic	27708008
SPS22_YEAST	SPS22	genetic	27708008
BUD31_YEAST	BUD31	genetic	27708008
URC2_YEAST	URC2	genetic	27708008
FIT1_YEAST	FIT1	genetic	27708008
RAD4_YEAST	RAD4	genetic	27708008
PDK2_YEAST	PKP2	genetic	27708008
ITC1_YEAST	ITC1	genetic	27708008
HOS2_YEAST	HOS2	genetic	27708008
FZF1_YEAST	FZF1	genetic	27708008
PEX8_YEAST	PEX8	genetic	27708008
TIM13_YEAST	TIM13	genetic	27708008
6PGD2_YEAST	GND2	genetic	27708008
MSC7_YEAST	MSC7	genetic	27708008
JEM1_YEAST	JEM1	genetic	27708008
INO1_YEAST	INO1	genetic	27708008
CSN12_YEAST	YJR084W	genetic	27708008
NNK1_YEAST	NNK1	genetic	27708008
MMM1_YEAST	MMM1	genetic	27708008
ARP6_YEAST	ARP6	genetic	27708008
ELO3_YEAST	ELO3	genetic	27708008
RIM11_YEAST	RIM11	genetic	27708008
SCS7_YEAST	SCS7	genetic	27708008
INO4_YEAST	INO4	genetic	27708008
CYC2_YEAST	CYC2	genetic	27708008
COQ7_YEAST	CAT5	genetic	27708008
FABD_YEAST	MCT1	genetic	27708008
PRM3_YEAST	PRM3	genetic	27708008
GYP5_YEAST	GYP5	genetic	27708008
CORO_YEAST	CRN1	genetic	26147656
TWF1_YEAST	TWF1	genetic	26147656
MK07_HUMAN	MAPK7	physical	27107014

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of AIM7_YEAST

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-137, AND MASSSPECTROMETRY.	18407956 [Abstract]