| UniProt ID | ARP3_YEAST | |
|---|---|---|
| UniProt AC | P47117 | |
| Protein Name | Actin-related protein 3 | |
| Gene Name | ARP3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 449 | |
| Subcellular Localization | Cytoplasm, cytoskeleton, actin patch . | |
| Protein Description | Functions as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the pointed end of the daughter actin filament (By similarity).. | |
| Protein Sequence | MSYLNNPAVVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKSSGVGAPSAVSNEASYFGNSTSATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFKYLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEADTSLRTAEKIKQEYCYVCPDIVKEFNKFDKDPSKFAQFVVENQEKTRRKVVDIGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCHTKKDYEEYGPEIVRNFSLFNMV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSYLNNPAV ------CCCCCCCEE | 38.02 | 22369663 | |
| 3 | Phosphorylation | -----MSYLNNPAVV -----CCCCCCCEEE | 16.49 | 22369663 | |
| 15 | Phosphorylation | AVVMDNGTGLTKLGF EEEEECCCCCEEEEC | 34.96 | 22369663 | |
| 18 | Phosphorylation | MDNGTGLTKLGFAGN EECCCCCEEEECCCC | 26.10 | 22369663 | |
| 27 | Phosphorylation | LGFAGNDSPSWVFPT EECCCCCCCCCCCCC | 25.49 | 22369663 | |
| 29 | Phosphorylation | FAGNDSPSWVFPTAI CCCCCCCCCCCCCHH | 39.56 | 21440633 | |
| 34 | Phosphorylation | SPSWVFPTAIATAAP CCCCCCCCHHHHCCC | 21.16 | 30377154 | |
| 38 | Phosphorylation | VFPTAIATAAPSNTK CCCCHHHHCCCCCCC | 19.76 | 30377154 | |
| 42 | Phosphorylation | AIATAAPSNTKKSSG HHHHCCCCCCCCCCC | 53.02 | 30377154 | |
| 48 | Phosphorylation | PSNTKKSSGVGAPSA CCCCCCCCCCCCCCC | 46.51 | 20377248 | |
| 87 | Ubiquitination | LSNNLSGKRGTEDLD CCCCCCCCCCCCCCC | 44.25 | 23749301 | |
| 137 | Ubiquitination | FWENSIFKYLRTEPE HHHHHHHHHHCCCCC | 41.53 | 23749301 | |
| 263 | Acetylation | LRTAEKIKQEYCYVC HHHHHHHHHHHEEEC | 48.41 | 24489116 | |
| 282 | Ubiquitination | KEFNKFDKDPSKFAQ HHHHHCCCCHHHHHH | 74.74 | 23749301 | |
| 282 | Acetylation | KEFNKFDKDPSKFAQ HHHHHCCCCHHHHHH | 74.74 | 24489116 | |
| 286 | Acetylation | KFDKDPSKFAQFVVE HCCCCHHHHHHHHHH | 50.54 | 24489116 | |
| 297 | Acetylation | FVVENQEKTRRKVVD HHHHCHHHHCCEEEE | 37.25 | 24489116 | |
| 301 | Acetylation | NQEKTRRKVVDIGYE CHHHHCCEEEECCCC | 43.23 | 22865919 | |
| 350 | Phosphorylation | IDVRKGLYNNIVLSG CCCCCCCCCCEEECC | 18.16 | 27017623 | |
| 360 | Phosphorylation | IVLSGGSTMFKDFGR EEECCCCHHHHHHHH | 29.87 | 27017623 | |
| 363 | Acetylation | SGGSTMFKDFGRRLQ CCCCHHHHHHHHHHH | 41.13 | 24489116 | |
| 374 | Acetylation | RRLQRDLKSIVNNRI HHHHHHHHHHHHCHH | 42.29 | 24489116 | |
| 384 | Phosphorylation | VNNRIAQSELLSGTK HHCHHHHHHHHCCCC | 22.61 | 24961812 | |
| 388 | Phosphorylation | IAQSELLSGTKSTGV HHHHHHHCCCCCCCC | 57.97 | 28889911 | |
| 390 | Phosphorylation | QSELLSGTKSTGVDV HHHHHCCCCCCCCEE | 20.60 | 24961812 | |
| 391 | Ubiquitination | SELLSGTKSTGVDVS HHHHCCCCCCCCEEE | 49.93 | 23749301 | |
| 430 | Succinylation | KGYCHTKKDYEEYGP CCCCCCCCCHHHHCH | 67.70 | 23954790 | |
| 435 | Phosphorylation | TKKDYEEYGPEIVRN CCCCHHHHCHHHHHH | 26.49 | 21440633 | |
| 444 | Phosphorylation | PEIVRNFSLFNMV-- HHHHHHHHHHCCC-- | 35.28 | 21440633 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARP3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARP3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARP3_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-388, AND MASSSPECTROMETRY. | |
