| UniProt ID | PEX18_YEAST | |
|---|---|---|
| UniProt AC | P38855 | |
| Protein Name | Peroxisomal membrane protein PEX18 | |
| Gene Name | PEX18 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 283 | |
| Subcellular Localization |
Cytoplasm . Peroxisome membrane Peripheral membrane protein Cytoplasmic side . |
|
| Protein Description | Involved in peroxisome biogenesis and the import of peroxisomal matrix proteins that contain the peroxisomal targeting sequence PTS2. Required for peroxisomal targeting of PEX7 and growth on oleate.. | |
| Protein Sequence | MNSNRCQTNEVNKFISSTEKGPFTGRDNTLSFNKIGSRLNSPPILKDKIELKFLQHSEDLNQSRSYVNIRPRTLEDQSYKFEAPNLNDNETSWAKDFRYNFPKNVEPPIENQIANLNINNGLRTSQTDFPLGFYSQKNFNIASFPVVDHQIFKTTGLEHPINSHIDSLINAEFSELEASSLEEDVHTEEENSGTSLEDEETAMKGLASDIIEFCDNNSANKDVKERLNSSKFMGLMGSISDGSIVLKKDNGTERNLQKHVGFCFQNSGNWAGLEFHDVEDRIA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MNSNRCQTNE -----CCCCCCCHHH | 25.09 | 19795423 | |
| 8 | Phosphorylation | MNSNRCQTNEVNKFI CCCCCCCHHHHHHHH | 36.65 | 19795423 | |
| 16 | Phosphorylation | NEVNKFISSTEKGPF HHHHHHHHCCCCCCC | 34.05 | 19795423 | |
| 17 | Phosphorylation | EVNKFISSTEKGPFT HHHHHHHCCCCCCCC | 35.45 | 19795423 | |
| 18 | Phosphorylation | VNKFISSTEKGPFTG HHHHHHCCCCCCCCC | 34.62 | 19795423 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PEX18_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PEX18_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PEX18_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...