APT2_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: APT2_YEAST
• UniProt AC: P36973
• Protein Name: Adenine phosphoribosyltransferase 2
• Gene Name: APT2
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 181
• Subcellular Localization: Cytoplasm.
• Protein Description: Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis. May lack catalytic activity..
• Protein Sequence: MSISESYAKEIKTAFRQFTDFPIEGEQFEDFLPIIGNPTLFQKLVHTFKTHLEEKFGKEKIDFIAGIEARGLLFGPSLALALGVGFVPIRRVGKLPGECASITFTKLDHEEIFEMQVEAIPFDSNVVVVDDVLATGGTAYAAGDLIRQVGAHILEYDFVLVLDSLHGEEKLSAPIFSILHS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSISESYAK ------CCCCHHHHH	34.52	22814378
2	Phosphorylation	------MSISESYAK ------CCCCHHHHH	34.52	27717283
4	Phosphorylation	----MSISESYAKEI ----CCCCHHHHHHH	17.12	27717283
6	Phosphorylation	--MSISESYAKEIKT --CCCCHHHHHHHHH	24.49	27717283
7	Phosphorylation	-MSISESYAKEIKTA -CCCCHHHHHHHHHH	20.03	28132839

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of APT2_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of APT2_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of APT2_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
APT1_YEAST	APT1	physical	18719252
ADK_YEAST	ADO1	genetic	16941010

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.