dbPTM

APT1_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	APT1_YEAST
UniProt AC	P49435
Protein Name	Adenine phosphoribosyltransferase 1
Gene Name	APT1
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	187
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis..
Protein Sequence	MSIASYAQELKLALHQYPNFPSEGILFEDFLPIFRNPGLFQKLIDAFKLHLEEAFPEVKIDYIVGLESRGFLFGPTLALALGVGFVPVRKAGKLPGECFKATYEKEYGSDLFEIQKNAIPAGSNVIIVDDIIATGGSAAAAGELVEQLEANLLEYNFVMELDFLKGRSKLNAPVFTLLNAQKEALKK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSIASYAQE ------CCHHHHHHH	27.19	30377154
5	Phosphorylation	---MSIASYAQELKL ---CCHHHHHHHHHH	21.23	30377154
42	Acetylation	RNPGLFQKLIDAFKL CCCCHHHHHHHHHHH	39.82	24489116
68	Phosphorylation	DYIVGLESRGFLFGP EEEEECCCCCCCCCH	42.62	28889911
93	Acetylation	VPVRKAGKLPGECFK EEHHHCCCCCCHHHH	57.26	24489116
100	Acetylation	KLPGECFKATYEKEY CCCCHHHHHHHHHHH	52.02	22865919
105	Acetylation	CFKATYEKEYGSDLF HHHHHHHHHHCCCCH	45.91	24489116
169	Acetylation	DFLKGRSKLNAPVFT HHHCCHHCCCCHHHH	44.38	24489116
182	Acetylation	FTLLNAQKEALKK-- HHHHHHHHHHHHC--	42.41	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of APT1_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of APT1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of APT1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ADE_YEAST	AAH1	genetic	3072477
APT2_YEAST	APT2	genetic	18408719
APT2_YEAST	APT2	genetic	16941010
ADK_YEAST	ADO1	genetic	16941010
ADE_YEAST	AAH1	genetic	21623372
DCOR_YEAST	SPE1	genetic	21623372
PDX3_YEAST	PDX3	genetic	21623372
ELO2_YEAST	ELO2	genetic	21623372
SUR1_YEAST	SUR1	genetic	21623372
CSG2_YEAST	CSG2	genetic	21623372
RPE_YEAST	RPE1	genetic	21623372
COQ3_YEAST	COQ3	genetic	21623372
APT1_YEAST	APT1	physical	22940862
YRA2_YEAST	YRA2	genetic	27708008
CDC24_YEAST	CDC24	genetic	27708008
PRP6_YEAST	PRP6	genetic	27708008
TECR_YEAST	TSC13	genetic	27708008
GLE1_YEAST	GLE1	genetic	27708008
ERF3_YEAST	SUP35	genetic	27708008
MOB2_YEAST	MOB2	genetic	27708008
ACT_YEAST	ACT1	genetic	27708008
TEL2_YEAST	TEL2	genetic	27708008
MED6_YEAST	MED6	genetic	27708008
CDC12_YEAST	CDC12	genetic	27708008
CDC11_YEAST	CDC11	genetic	27708008
AFG2_YEAST	AFG2	genetic	27708008
DCP2_YEAST	DCP2	genetic	27708008
NOG2_YEAST	NOG2	genetic	27708008
IF6_YEAST	TIF6	genetic	27708008
BUR1_YEAST	SGV1	genetic	27708008
IES1_YEAST	IES1	genetic	27708008
VAM7_YEAST	VAM7	genetic	27708008
MDM34_YEAST	MDM34	genetic	27708008
ELP2_YEAST	ELP2	genetic	27708008
BAS1_YEAST	BAS1	genetic	27708008
IDH1_YEAST	IDH1	genetic	27708008
ADE_YEAST	AAH1	genetic	27708008
VPS17_YEAST	VPS17	genetic	27708008
SGF11_YEAST	SGF11	genetic	27708008
SVS1_YEAST	SVS1	genetic	27708008
MED1_YEAST	MED1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of APT1_YEAST

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-68, AND MASSSPECTROMETRY.	18407956 [Abstract]