dbPTM

COQ3_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	COQ3_YEAST
UniProt AC	P27680
Protein Name	Ubiquinone biosynthesis O-methyltransferase, mitochondrial {ECO:0000255\|HAMAP-Rule:MF_03190, ECO:0000305}
Gene Name	COQ3 {ECO:0000255\|HAMAP-Rule:MF_03190, ECO:0000303\|PubMed:1885593}
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	312
Subcellular Localization	Mitochondrion inner membrane Peripheral membrane protein Matrix side .
Protein Description	O-methyltransferase that catalyzes the 2 O-methylation steps in the ubiquinone biosynthetic pathway. Catalyzes the methylation of 3,4-dihydroxy-5-hexaprenylbenzoate (DHHB) to 3-methoxy-4-hydroxy-5-hexaprenylbenzoate (HMHB) and the methylation of 2-hexaprenyl-3-methyl-5-hydroxy-6-methoxy-1,4-benzoquinol (3-demethylubiquinol-6) to ubiquinol-6..
Protein Sequence	MLLRSRFLKVIHVRKQLSACSRFAIQTQTRCKSTDASEDEVKHFQELAPTWWDTDGSQRILHKMNLTRLDFVQRTVRNQVKIQNPEIFVPGFNYKEFLPEYVCDNIQREMQESIETNLDKRPEVSVLDVGCGGGILSESLARLKWVKNVQGIDLTRDCIMVAKEHAKKDPMLEGKINYECKALEDVTGQFDIITCMEMLEHVDMPSEILRHCWSRLNPEKGILFLSTINRDLISWFTTIFMGENVLKIVPKGTHHLSKYINSKEILAWFNDNYSGQFRLLDLKGTMYLPYQGWVEHDCSDVGNYFMAIQRLN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
155	Phosphorylation	NVQGIDLTRDCIMVA CCCCCCCHHHHHHHH	22.25	27017623

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of COQ3_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of COQ3_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of COQ3_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
COQ4_YEAST	COQ4	physical	15792955
COQ6_YEAST	COQ6	physical	15792955
PCL8_YEAST	PCL8	genetic	11943203
PCL10_YEAST	PCL10	genetic	11943203
ERG2_YEAST	ERG2	genetic	19345667
PEP12_YEAST	PEP12	genetic	19345667
VPS45_YEAST	VPS45	genetic	19345667
TLG2_YEAST	TLG2	genetic	19345667
RAD1_YEAST	RAD1	genetic	12783866
HSP71_YEAST	SSA1	physical	22940862
COQ8_YEAST	COQ8	genetic	24406904
COQ4_YEAST	COQ4	physical	25631044
COQ5_YEAST	COQ5	physical	25631044
COQ6_YEAST	COQ6	physical	25631044
COQ7_YEAST	CAT5	physical	25631044
COQ9_YEAST	COQ9	physical	25631044
H2B1_YEAST	HTB1	physical	25631044
COQ11_YEAST	YLR290C	physical	25631044
HSP71_YEAST	SSA1	physical	25631044
HSP73_YEAST	SSA3	physical	25631044
ATPJ_YEAST	TIM11	physical	25631044
HSP72_YEAST	SSA2	physical	25631044
BMH1_YEAST	BMH1	physical	25631044
HSP74_YEAST	SSA4	physical	25631044
BMH2_YEAST	BMH2	physical	25631044
SAS4_YEAST	SAS4	physical	25631044
RT21_YEAST	MRP21	physical	25631044
VDAC1_YEAST	POR1	physical	25631044
PEF1_YEAST	PEF1	physical	25631044
MPPA_YEAST	MAS2	physical	25631044
HPC2_YEAST	HPC2	physical	25631044
COQ8A_HUMAN	ADCK3	physical	26866375

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of COQ3_YEAST

Related Literatures of Post-Translational Modification