| UniProt ID | COQ6_YEAST | |
|---|---|---|
| UniProt AC | P53318 | |
| Protein Name | Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial {ECO:0000255|HAMAP-Rule:MF_03193, ECO:0000305|PubMed:12721307} | |
| Gene Name | COQ6 {ECO:0000255|HAMAP-Rule:MF_03193, ECO:0000303|PubMed:12721307} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 479 | |
| Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Matrix side . |
|
| Protein Description | FAD-dependent monooxygenase required for the C5-ring hydroxylation during ubiquinone biosynthesis. Catalyzes the hydroxylation of 3-hexaprenyl-4-hydroxybenzoic acid (HHB) to 3-hexaprenyl-4,5-dihydroxybenzoic acid (DHHB). The electrons required for the hydroxylation reaction may be funneled indirectly from NADPH via ferredoxin (YAH1) and ferredoxin reductase (ARH1) to COQ6. Can also use 3-hexaprenyl-4-aminobenzoic acid (HAB) as substrate.. | |
| Protein Sequence | MFFSKVMLTRRILVRGLATAKSSAPKLTDVLIVGGGPAGLTLAASIKNSPQLKDLKTTLVDMVDLKDKLSDFYNSPPDYFTNRIVSVTPRSIHFLENNAGATLMHDRIQSYDGLYVTDGCSKATLDLARDSMLCMIEIINIQASLYNRISQYDSKKDSIDIIDNTKVVNIKHSDPNDPLSWPLVTLSNGEVYKTRLLVGADGFNSPTRRFSQIPSRGWMYNAYGVVASMKLEYPPFKLRGWQRFLPTGPIAHLPMPENNATLVWSSSERLSRLLLSLPPESFTALINAAFVLEDADMNYYYRTLEDGSMDTDKLIEDIKFRTEEIYATLKDESDIDEIYPPRVVSIIDKTRARFPLKLTHADRYCTDRVALVGDAAHTTHPLAGQGLNMGQTDVHGLVYALEKAMERGLDIGSSLSLEPFWAERYPSNNVLLGMADKLFKLYHTNFPPVVALRTFGLNLTNKIGPVKNMIIDTLGGNEK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COQ6_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COQ6_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COQ6_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
