YNO3_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YNO3_YEAST
• UniProt AC: P53908
• Protein Name: Uncharacterized membrane protein YNL143C
• Gene Name: YNL143C
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 130
• Subcellular Localization: Membrane; Multi-pass membrane protein.
• Protein Sequence: MREQLKLFTREIVDFTFLILSGFDYYQTLLISSNSSKKRPKDSSLLSEKKKKKKKKKKDVLSYLSYLKDLPFVPFLFWQPGYSQREKNPRQHSLFIMTITKPGMISMADMNYVVSKNRSLNRPAERGGNR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
21	Phosphorylation	DFTFLILSGFDYYQT HHHHHHHCCCCHHHH	30.35	21440633
43	Phosphorylation	SKKRPKDSSLLSEKK CCCCCCCCCCCCHHH	29.07	24961812
44	Phosphorylation	KKRPKDSSLLSEKKK CCCCCCCCCCCHHHH	43.39	24961812

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YNO3_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YNO3_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YNO3_YEAST !!

Protein-Protein Interaction

Oops, there are no PPI records of YNO3_YEAST !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.