UniProt ID | YO289_YEAST | |
---|---|---|
UniProt AC | Q12012 | |
Protein Name | Uncharacterized protein YOR289W | |
Gene Name | YOR289W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 251 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MALRLFRKSSFFAKISMEGPKGSSPFAFYAFYQLYSHLNPGKSSSLSLEDIRRRLYPDFKIDYNEKTSLFITWKKKSNKHHTIDTNEENYILRGCIGTFAKMPIAHGIEKYSLIAALEDRRFSPIQKRELVDLKCSCNILGNFKTIFRGGGNPNGDIFDWELGKHGIELYFKHPKTGTTCSATFLPDVMPEQHWNKEDTFANLIEKAGYWGNISEVMDNFETYFIEVIRYEGKKSSITYEEFNKQLKDIEA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
60 | Ubiquitination | RRLYPDFKIDYNEKT HHHCCCCEEECCCCE | 41.89 | 24961812 | |
63 | Phosphorylation | YPDFKIDYNEKTSLF CCCCEEECCCCEEEE | 28.79 | 19779198 | |
85 | Phosphorylation | NKHHTIDTNEENYIL CCCCEECCCCCCEEE | 40.45 | 27017623 | |
110 | Acetylation | PIAHGIEKYSLIAAL CCCCCCHHHHHHHHH | 37.91 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YO289_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YO289_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YO289_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
JIP4_YEAST | JIP4 | physical | 16554755 | |
METE_YEAST | MET6 | genetic | 27708008 | |
IES5_YEAST | IES5 | genetic | 27708008 | |
PHO4_YEAST | PHO4 | genetic | 27708008 | |
GTR2_YEAST | GTR2 | genetic | 27708008 | |
SDS3_YEAST | SDS3 | genetic | 27708008 | |
PRY1_YEAST | PRY1 | genetic | 27708008 | |
RS30A_YEAST | RPS30A | genetic | 27708008 | |
RS30B_YEAST | RPS30A | genetic | 27708008 | |
NUP53_YEAST | NUP53 | genetic | 27708008 | |
PFKA2_YEAST | PFK2 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...