dbPTM

SNF11_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SNF11_YEAST
UniProt AC	P38956
Protein Name	Transcription regulatory protein SNF11
Gene Name	SNF11
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	169
Subcellular Localization	Nucleus .
Protein Description	Involved in transcriptional activation. Component of the SWI/SNF complex, an ATP-dependent chromatin remodeling complex, which is required for the positive and negative regulation of gene expression of a large number of genes. It changes chromatin structure by altering DNA-histone contacts within a nucleosome, leading eventually to a change in nucleosome position, thus facilitating or repressing binding of gene-specific transcription factors..
Protein Sequence	MSSEIAYSNTNTNTENENRNTGAGVDVNTNANANANATANATANATANATAELNLPTVDEQRQYKVQLLLHINSILLARVIQMNNSLQNNLQNNINNSNNNNIIRIQQLISQFLKRVHANLQCISQINQGVPSAKPLILTPPQLANQQQPPQDILSKLYLLLARVFEIW

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
2	Acetylation	------MSSEIAYSN ------CCCCCCCCC	36.36	22814378

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SNF11_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SNF11_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SNF11_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SWI1_YEAST	SWI1	physical	7623818
SNF2_YEAST	SNF2	physical	7623818
SNF5_YEAST	SNF5	physical	7623818
SNF6_YEAST	SNF6	physical	7623818
SWI3_YEAST	SWI3	physical	7623818
TAF14_YEAST	TAF14	physical	7623818
ARP9_YEAST	ARP9	physical	7623818
ARP7_YEAST	ARP7	physical	7623818
SNF12_YEAST	SNF12	physical	7623818
SNF2_YEAST	SNF2	physical	16429126
SNF5_YEAST	SNF5	physical	16429126
SWI3_YEAST	SWI3	physical	16429126
SUS1_YEAST	SUS1	genetic	17314980
PLPHP_YEAST	YBL036C	genetic	17314980
PAT1_YEAST	PAT1	genetic	17314980
SLX5_YEAST	SLX5	genetic	17314980
FUS3_YEAST	FUS3	genetic	17314980
RSC6_YEAST	RSC6	genetic	17314980
QCR9_YEAST	QCR9	genetic	27708008
RCY1_YEAST	RCY1	genetic	27708008
FMT_YEAST	FMT1	genetic	27708008
SNT1_YEAST	SNT1	genetic	27708008
THRC_YEAST	THR4	genetic	27708008
BCS1_YEAST	BCS1	genetic	27708008
RLA4_YEAST	RPP2B	genetic	27708008
STP1_YEAST	STP1	genetic	27708008
GET1_YEAST	GET1	genetic	27708008
HUR1_YEAST	HUR1	genetic	27708008
CBP4_YEAST	CBP4	genetic	27708008
NPR3_YEAST	NPR3	genetic	27708008
SODM_YEAST	SOD2	genetic	27708008
COX23_YEAST	COX23	genetic	27708008
DAL81_YEAST	DAL81	genetic	27708008
LSM1_YEAST	LSM1	genetic	27708008
DBR1_YEAST	DBR1	genetic	27708008
MMM1_YEAST	MMM1	genetic	27708008
FKS1_YEAST	FKS1	genetic	27708008
MDM38_YEAST	MDM38	genetic	27708008
IDH2_YEAST	IDH2	genetic	27708008
BRR1_YEAST	BRR1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SNF11_YEAST

Related Literatures of Post-Translational Modification